| Clone Name | bast56a08 |
|---|---|
| Clone Library Name | barley_pub |
>YMD8_YEAST (Q03697) Hypothetical 49.6 kDa protein in CAT2-AMD1 intergenic| region Length = 442 Score = 30.0 bits (66), Expect = 2.8 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 196 VSYCYVAVWIFLSFTVIVYNKYILDPK-MYNWPFPISLTMVHMA 324 V +V W F S + +YN+++ DPK +P+ +T H A Sbjct: 5 VFLAFVFGWYFCSIALSIYNRWMFDPKDGLGIGYPVLVTTFHQA 48
>HIS5_BIFLO (Q8G4S6) Imidazole glycerol phosphate synthase subunit hisH (EC| 2.4.2.-) (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit hisH) (ImGP synthase subunit hisH) (IGPS subunit hisH) Length = 215 Score = 29.3 bits (64), Expect = 4.7 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = -3 Query: 210 VAVGDEHLAEHRLRHGPLAAGLLRHGSGGAAGGSVIRLRA 91 V VG++ + EH L HG AAG+ G GGSV L A Sbjct: 80 VCVGEQIMFEHGLEHGAHAAGI------GLIGGSVNLLDA 113
>YDB1_SCHPO (Q10354) Hypothetical protein C22E12.01 in chromosome I| Length = 374 Score = 28.9 bits (63), Expect = 6.2 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +1 Query: 181 LRKVLVSYCYVAVWIFLSFTVIVYNKYILDPKMYNWPFPISLTMVHM 321 + +V++ V W F S + + NK+I ++ FP+ L+ M Sbjct: 47 ITRVVIIVLIVLAWYFFSLLLSMMNKWIFSESKMDFQFPLFLSSCQM 93
>SMS1_CHICK (Q7T3T4) Phosphatidylcholine:ceramide cholinephosphotransferase 1| (EC 2.7.-.-) (Sphingomyelin synthase 1) (MOB protein) Length = 417 Score = 28.9 bits (63), Expect = 6.2 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +1 Query: 169 SESVLRKVLVSYCYVAVWIFLSFTVIVYNKYILDPKMYNWPFP 297 ++ VL++ + VW + F N + P+ Y+WPFP Sbjct: 356 NQQVLKEASQTNLLARVWWYKPFQYFEKNVQGIVPRSYHWPFP 398
>SYV_SULSO (Q97ZK9) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 842 Score = 28.5 bits (62), Expect = 8.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 217 VWIFLSFTVIVYNKYILDPKMYNWPFPISLTM 312 VWI S TV+ K+ D ++N FP SL + Sbjct: 499 VWIDSSVTVLYLTKFYEDKNVFNRTFPASLRL 530
>TPT_SPIOL (P11869) Triose phosphate/phosphate translocator, chloroplast| precursor (cTPT) (p36) (E29) Length = 404 Score = 28.5 bits (62), Expect = 8.1 Identities = 14/44 (31%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Frame = +1 Query: 193 LVSYCYVAVWIFLSFTVIVYNKYILDPKMYNW-PFPISLTMVHM 321 LV+ + +W FL+ +++N IL+ K+YN+ P+P ++++H+ Sbjct: 100 LVTGSFFFMWYFLN---VIFN--ILNKKIYNYFPYPYFVSVIHL 138 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,612,772 Number of Sequences: 219361 Number of extensions: 285833 Number of successful extensions: 934 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)