| Clone Name | bast56a06 |
|---|---|
| Clone Library Name | barley_pub |
>SPR2B_MOUSE (O70554) Small proline-rich protein 2B| Length = 98 Score = 31.6 bits (70), Expect = 1.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 11 PKPKTPDLCCDPIPPPK 61 P+P P +CC+P PPPK Sbjct: 33 PEPCPPPVCCEPCPPPK 49 Score = 29.6 bits (65), Expect = 4.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 11 PKPKTPDLCCDPIPPP 58 P+P P +CC+P PPP Sbjct: 51 PEPCPPPVCCEPCPPP 66
>CO4A2_CAEEL (P17140) Collagen alpha-2(IV) chain precursor (Lethal protein 2)| Length = 1758 Score = 31.6 bits (70), Expect = 1.2 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -2 Query: 450 DGRDGTAERKASRAFSGRPAEAYEQRMAERCGSVGEAGM 334 DG G K R F+G P E E A R G G+AG+ Sbjct: 1002 DGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGL 1040
>CO4A2_ASCSU (P27393) Collagen alpha-2(IV) chain precursor| Length = 1763 Score = 29.3 bits (64), Expect = 5.8 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = -2 Query: 450 DGRDGTAERKASRAFSGRPAEAYEQRMAERCGSVGEAGM 334 DG G K R F+G P E E A R G GE G+ Sbjct: 1004 DGLPGLPGVKGDRGFNGLPGEKGEPGPAARDGEKGEPGL 1042
>HRX_HUMAN (Q03164) Zinc finger protein HRX (ALL-1) (Trithorax-like protein)| Length = 3969 Score = 28.9 bits (63), Expect = 7.6 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = +2 Query: 323 LSSHIPASPTEPHLSAILCSYASAGLPEKALEAFRSAVPSLPSPISSMP 469 LSS + ASPT P G P RSA PS+P P P Sbjct: 3501 LSSAVQASPTSP-----------GGSPSSPSSGQRSASPSVPGPTKPKP 3538
>ZC3H5_HUMAN (Q9C0B0) Zinc finger CCCH-type domain-containing protein 5| Length = 810 Score = 28.5 bits (62), Expect = 9.9 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +2 Query: 335 IPASPTEPH---LSAILCSYASAGLP 403 +P SP+ PH LSA+LC +S G P Sbjct: 354 VPVSPSSPHAPDLSALLCRNSSLGSP 379
>CAFF_RIFPA (P30754) Fibril-forming collagen alpha chain (Fragment)| Length = 1027 Score = 28.5 bits (62), Expect = 9.9 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 447 GRDGTAERKASRAFSGRPAEAYEQRMAERCGSVGEAGM 334 G++G + +GRP E E +A R GS G AG+ Sbjct: 844 GQEGAPGKDGLPGLAGRPGERGEPGVAGRAGSQGLAGL 881 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,844,524 Number of Sequences: 219361 Number of extensions: 422364 Number of successful extensions: 1906 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1841 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1902 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)