| Clone Name | bast55h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich p... | 29 | 5.0 | 2 | K0329_HUMAN (O15040) Protein KIAA0329/KIAA0297 | 29 | 6.6 | 3 | TRAF4_HUMAN (Q9BUZ4) TNF receptor-associated factor 4 (Cysteine-... | 29 | 6.6 |
|---|
>MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich protein| Length = 145 Score = 29.3 bits (64), Expect = 5.0 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +3 Query: 303 CPRTISGARRGCALS*CPCPSRPLRLRCGSLPTRLECPPRSC 428 CP T A CA CPCP +P PT+ C P+ C Sbjct: 61 CPATCPAA---CA---CPCPMKP------CCPTKCTCCPKKC 90
>K0329_HUMAN (O15040) Protein KIAA0329/KIAA0297| Length = 1411 Score = 28.9 bits (63), Expect = 6.6 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = -3 Query: 438 RMRGSSSADTPASSVRNRSAAVMVSTGTDISSGHIP 331 R+RGSS A + AS R+RS+++ TD SG +P Sbjct: 392 RLRGSSMASSVASEPRSRSSSL---NSTDSGSGLLP 424
>TRAF4_HUMAN (Q9BUZ4) TNF receptor-associated factor 4 (Cysteine-rich domain| associated with RING and Traf domains protein 1) (Malignant 62) (RING finger protein 83) Length = 470 Score = 28.9 bits (63), Expect = 6.6 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 279 QQSCSRRACPRTISGARRGCALS*CPCPSR-PLRLRCGSLPTRL--ECPPR 422 ++ C R + G C+ + PCP+R P++L LP L +CP R Sbjct: 87 EEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKR 137 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,677,812 Number of Sequences: 219361 Number of extensions: 802525 Number of successful extensions: 2400 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2399 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)