| Clone Name | bast55g10 |
|---|---|
| Clone Library Name | barley_pub |
>AFRP_STRGR (Q9ZN78) A-factor receptor protein (A-factor-binding protein)| Length = 276 Score = 30.4 bits (67), Expect = 2.2 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 6/39 (15%) Frame = +2 Query: 317 VPEADAGAVRPRRG------HALPHVAHPAARGHVRPDG 415 V EAD+G R H LP +AHP H++P+G Sbjct: 159 VSEADSGRADLRGQVAEMWRHILPSIAHPGVIAHIKPEG 197
>M3K11_HUMAN (Q16584) Mitogen-activated protein kinase kinase kinase 11 (EC| 2.7.11.25) (Mixed lineage kinase 3) (Src-homology 3 domain-containing proline-rich kinase) Length = 847 Score = 30.4 bits (67), Expect = 2.2 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 352 ARPRTSPCRSSGCPWTCATGRPWRSPTPS 438 +RPR SP RS PW+ + P SP PS Sbjct: 765 SRPRPSPLRSRIDPWSFVSAGPRPSPLPS 793
>PSV_DICDI (P08798) Prespore vesicle protein precursor (PSV)| Length = 513 Score = 30.0 bits (66), Expect = 2.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 419 HGRPVAHVHGQPDERHGEVRGLAEAGPLQHPLLERHA 309 H +P HV Q ++H + A P+QH ++HA Sbjct: 347 HAKPAQHVAQQQQQQHAKPAAHTAAKPVQHNAQQQHA 383
>GSTX2_MAIZE (P50472) Probable glutathione S-transferase BZ2 (EC 2.5.1.18)| (Protein bronze-2) Length = 236 Score = 29.6 bits (65), Expect = 3.7 Identities = 20/45 (44%), Positives = 25/45 (55%) Frame = +2 Query: 278 LPAVRAVQRAEHGVPEADAGAVRPRRGHALPHVAHPAARGHVRPD 412 LPA+RA +R HG+ DA A G + AHPAA+ V PD Sbjct: 172 LPALRACERL-HGLSLIDASATPLLDGWSQRFAAHPAAK-RVLPD 214
>SYNJ1_MOUSE (Q8CHC4) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) Length = 1574 Score = 29.3 bits (64), Expect = 4.8 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 8/42 (19%) Frame = +1 Query: 349 SARPRTSPCRSSGCPWTCATG---RPWRSPT-----PSSSGS 450 S+ PRTSPC+S P A RP R+P+ PSS GS Sbjct: 1043 SSSPRTSPCQSPTVPEYSAPSLPIRPSRAPSRTPGPPSSQGS 1084
>DDX56_HUMAN (Q9NY93) Probable ATP-dependent RNA helicase DDX56 (EC 3.6.1.-)| (DEAD box protein 56) (ATP-dependent 61 kDa nucleolar RNA helicase) (DEAD-box protein 21) Length = 547 Score = 28.9 bits (63), Expect = 6.3 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +2 Query: 290 RAVQRAEHGVPEADAGAVRPRRGHALPHVAHPAARGHVRP 409 R +Q H +P A V+P GH ++ PA RG VRP Sbjct: 469 RDLQLLRHDLPLHPA-VVKPHLGHVPDYLVPPALRGLVRP 507
>SLDA1_GLUOX (Q70JN9) Glycerol dehydrogenase large subunit precursor (EC| 1.1.99.22) (Gluconate/polyol dehydrogenase large subunit) (D-sorbitol dehydrogenase subunit sldA) (SLDH) (D-arabitol dehydrogenase large subunit) (ARDH) Length = 743 Score = 28.5 bits (62), Expect = 8.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 376 RSSGCPWTCATGRPWRSPTPSSSGS 450 R++G PW TG PW TP++ GS Sbjct: 639 RANG-PWGLPTGLPWEIGTPNNGGS 662
>RS5_NITMU (Q2YAY0) 30S ribosomal protein S5| Length = 180 Score = 28.5 bits (62), Expect = 8.2 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = -1 Query: 440 DDGVGLLHGR----PVAHVHGQPDERHGEVRGLAEAGPLQHPLLERH 312 D GVG+ G+ PVA + R ++ + G LQHP++ RH Sbjct: 54 DGGVGMGKGKSREVPVAVQKAMDEARRKMIKVSLKNGTLQHPVIGRH 100
>SLDA2_GLUOX (Q8KIL1) Glycerol dehydrogenase large subunit precursor (EC| 1.1.99.22) (Gluconate/polyol dehydrogenase large subunit) (D-sorbitol dehydrogenase subunit sldA) (SLDH) (D-arabitol dehydrogenase large subunit) (ARDH) Length = 740 Score = 28.5 bits (62), Expect = 8.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 376 RSSGCPWTCATGRPWRSPTPSSSGS 450 R++G PW TG PW TP++ GS Sbjct: 635 RANG-PWGLPTGLPWEIGTPNNGGS 658 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.127 0.488 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,274,466 Number of Sequences: 219361 Number of extensions: 810978 Number of successful extensions: 3039 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3037 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)