| Clone Name | bast55f03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DGKQ_HUMAN (P52824) Diacylglycerol kinase theta (EC 2.7.1.107) (... | 33 | 0.31 | 2 | CB22_SOYBN (P09755) Chlorophyll a-b binding protein 2, chloropla... | 29 | 5.8 | 3 | TRPG_PYRKO (Q9YGB2) Anthranilate synthase component II (EC 4.1.3... | 28 | 9.9 |
|---|
>DGKQ_HUMAN (P52824) Diacylglycerol kinase theta (EC 2.7.1.107) (Diglyceride| kinase theta) (DGK-theta) (DAG kinase theta) Length = 942 Score = 33.1 bits (74), Expect = 0.31 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 4/88 (4%) Frame = +2 Query: 104 PAVDRLAVCNLLSGACHVLPPLRCDWFFDYFGTSAHAVLTGADCCPDDG----QRQALDP 271 P+ R VC G+ VL +RC+W G AH+ L A P+ G + L P Sbjct: 192 PSGARCEVCRKTCGSSDVLAGVRCEW----CGVQAHS-LCSAALAPECGFGRLRSLVLPP 246 Query: 272 ASFKVLVVGVSDDRRRYVLRTFSSGEPG 355 A ++L G S + ++ GE G Sbjct: 247 ACVRLLPGGFSKTQSFRIVEAAEPGEGG 274
>CB22_SOYBN (P09755) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 256 Score = 28.9 bits (63), Expect = 5.8 Identities = 25/61 (40%), Positives = 32/61 (52%) Frame = +2 Query: 248 GQRQALDPASFKVLVVGVSDDRRRYVLRTFSSGEPGWSAPSECFDPVERGIFGPFSGAAP 427 GQ L P++ ++ V VS R+ +T SSG P W P D V+ GPFSG AP Sbjct: 15 GQAMKLAPSTPELGVGRVS--MRKTAPKTVSSGSP-WYGP----DRVK--YLGPFSGEAP 65 Query: 428 S 430 S Sbjct: 66 S 66
>TRPG_PYRKO (Q9YGB2) Anthranilate synthase component II (EC 4.1.3.27)| (Glutamine amido-transferase) Length = 192 Score = 28.1 bits (61), Expect = 9.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -2 Query: 438 VAHDGAAPLNGPKMPRSTGSKHSLGALQ 355 V HDG L G K P + G HSL L+ Sbjct: 105 VKHDGKGVLRGIKNPLTAGRYHSLAVLE 132 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,586,717 Number of Sequences: 219361 Number of extensions: 609163 Number of successful extensions: 1930 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1930 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)