| Clone Name | bast55d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CXM3A_CONSE (P60207) Mu-conotoxin SmIIIA precursor (Fragment) | 30 | 2.3 | 2 | KR171_HUMAN (Q9BYP8) Keratin-associated protein 17-1 (Keratin as... | 30 | 4.0 | 3 | CFC1_MOUSE (P97766) Cryptic protein precursor | 29 | 5.2 | 4 | SETB1_HUMAN (Q15047) Histone-lysine N-methyltransferase, H3 lysi... | 28 | 8.9 | 5 | SCA4_RICRH (Q9AJ81) Antigenic heat-stable 120 kDa protein (PS120... | 28 | 8.9 |
|---|
>CXM3A_CONSE (P60207) Mu-conotoxin SmIIIA precursor (Fragment)| Length = 31 Score = 30.4 bits (67), Expect = 2.3 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 117 GRRGCGAGSTPAWC*ASSRCCGR 185 GRRGC + WC SRCCGR Sbjct: 12 GRRGCSS----RWCRDHSRCCGR 30
>KR171_HUMAN (Q9BYP8) Keratin-associated protein 17-1 (Keratin associated| protein 16.1) Length = 105 Score = 29.6 bits (65), Expect = 4.0 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 93 GDRCEGWMGRRGCGAGSTPAWC*ASSRCCGRWC 191 G C G G GCG G + C SS CCG C Sbjct: 59 GSGCGGCGGCGGCGGGCCGSSCCGSS-CCGSGC 90
>CFC1_MOUSE (P97766) Cryptic protein precursor| Length = 202 Score = 29.3 bits (64), Expect = 5.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 78 PGYSAGDRCEGWMGRRGCGAGSTPAWC*ASSRCC 179 P Y G CE RR CGA AW S R C Sbjct: 114 PAYFTGRYCEHDQRRRDCGALGHGAWTLHSCRLC 147
>SETB1_HUMAN (Q15047) Histone-lysine N-methyltransferase, H3 lysine-9 specific 4| (EC 2.1.1.43) (Histone H3-K9 methyltransferase 4) (H3-K9-HMTase 4) (SET domain bifurcated 1) (ERG-associated protein with SET domain) (ESET) Length = 1291 Score = 28.5 bits (62), Expect = 8.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 174 TAMRLSTTPELSPPHTPDDPSIP 106 T + S P+L PPH P PSIP Sbjct: 942 TTSKDSHPPDLGPPHIPVPPSIP 964
>SCA4_RICRH (Q9AJ81) Antigenic heat-stable 120 kDa protein (PS120) (120 kDa| antigen) (Protein PS 120) (Fragment) Length = 1013 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 55 EKRRTLRGQATPPEIDARDGWVVGGVGRAQLRRGAEPHRGAVDGGV 192 ++++ L Q T PE++A DG++V AQ + P A+ G + Sbjct: 23 QEQKELLSQTTTPELEADDGFIVTSASSAQ----STPSISALSGNI 64 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,048,670 Number of Sequences: 219361 Number of extensions: 595405 Number of successful extensions: 2852 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2850 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)