| Clone Name | bast55c04 |
|---|---|
| Clone Library Name | barley_pub |
>ERF1_LYCES (Q84XB3) Ethylene-responsive transcription factor 1| (Ethylene-responsive element-binding factor 1) (EREBP-1) (ERF1-like protein) (LeERF1) Length = 244 Score = 59.3 bits (142), Expect = 4e-09 Identities = 33/76 (43%), Positives = 44/76 (57%), Gaps = 4/76 (5%) Frame = +1 Query: 214 YCRSASFGSLV---ADQWSESLPFRADDSDDMVVYGALRDAFSCGWLPDG-SFAAVKPEP 381 YCRS+SF SL+ + W + LP + +DS+DMV+YG L+DAFS GW P + VK EP Sbjct: 20 YCRSSSFSSLMPCLTESWGD-LPLKVNDSEDMVIYGFLQDAFSIGWTPSNLTSEEVKLEP 78 Query: 382 LPSPESCYGGFLYPDT 429 E + P T Sbjct: 79 REEIEPAMSTSVSPPT 94
>ERF13_ARATH (Q8L9K1) Ethylene-responsive transcription factor 13| (Ethylene-responsive element-binding factor 13) (EREBP-13) (AtERF13) Length = 226 Score = 52.0 bits (123), Expect = 7e-07 Identities = 32/79 (40%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Frame = +1 Query: 214 YCRSASFGSLVA-DQWSESLPFRADDSDDMVVYGALRDAFSCGWLPDGSFAAVKPEPLPS 390 Y R+ SF +++ D WS+ LP DDS DM +Y LRDA S GW P +V P P+ Sbjct: 16 YFRNPSFSNVILNDNWSD-LPLSVDDSQDMAIYNTLRDAVSSGWTP-----SVPPVTSPA 69 Query: 391 PESCYGGFLYPDTPPATSA 447 E + PPAT A Sbjct: 70 EE---------NKPPATKA 79
>ERF2_NICSY (Q9LW50) Ethylene-responsive transcription factor 2| (Ethylene-responsive element-binding factor 2) (EREBP-2) (NsERF2) Length = 237 Score = 51.2 bits (121), Expect = 1e-06 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 4/60 (6%) Frame = +1 Query: 214 YCRSASFGSLV---ADQWSESLPFRADDSDDMVVYGALRDAFSCGWLP-DGSFAAVKPEP 381 Y R++SF SL+ D W + LP + DDS+DMV+YG L DA + GW P + + +K EP Sbjct: 12 YHRTSSFSSLMPCLTDTWGD-LPLKVDDSEDMVIYGLLSDALTTGWTPFNLTSTEIKAEP 70
>ERF1A_ARATH (O80337) Ethylene-responsive transcription factor 1A| (Ethylene-responsive element-binding factor 1A) (EREBP-1A) (AtERF1) Length = 268 Score = 49.7 bits (117), Expect = 4e-06 Identities = 33/110 (30%), Positives = 48/110 (43%), Gaps = 12/110 (10%) Frame = +1 Query: 97 MLLNPASEALVLDSIRQHLMEDTXXXXXXXXXXXXXXX---------XYCRSASFGSLV- 246 M + S+ L+SIR+HL+ ++ Y R+ SF L Sbjct: 3 MTADSQSDYAFLESIRRHLLGESEPILSESTASSVTQSCVTGQSIKPVYGRNPSFSKLYP 62 Query: 247 --ADQWSESLPFRADDSDDMVVYGALRDAFSCGWLPDGSFAAVKPEPLPS 390 + W + LP + +DS+DM+VYG L DAF GW P S + PS Sbjct: 63 CFTESWGD-LPLKENDSEDMLVYGILNDAFHGGWEPSSSSSDEDRSSFPS 111
>ERF2_TOBAC (Q40479) Ethylene-responsive transcription factor 2| (Ethylene-responsive element-binding factor 2) (EREBP-2) (NtERF2) Length = 233 Score = 47.4 bits (111), Expect = 2e-05 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 4/55 (7%) Frame = +1 Query: 229 SFGSLV---ADQWSESLPFRADDSDDMVVYGALRDAFSCGWLP-DGSFAAVKPEP 381 SF SL+ D W + LP + DDS+DMV+YG L DA + GW P + + +K EP Sbjct: 13 SFSSLMPCLTDTWGD-LPLKVDDSEDMVIYGLLSDALTAGWTPFNLTSTEIKAEP 66
>ERF1_TOBAC (Q40476) Ethylene-responsive transcription factor 1| (Ethylene-responsive element-binding factor 1) (EREBP-1) (NtERF1) Length = 236 Score = 45.4 bits (106), Expect = 7e-05 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 3/48 (6%) Frame = +1 Query: 214 YCRSASFGSLV---ADQWSESLPFRADDSDDMVVYGALRDAFSCGWLP 348 Y R++SF L+ + W + LP + DDS+DMV+Y L+DA + GW P Sbjct: 21 YRRNSSFSRLIPCLTETWGD-LPLKVDDSEDMVIYTLLKDALNVGWSP 67
>ERF2_ARATH (O80338) Ethylene-responsive transcription factor 2| (Ethylene-responsive element-binding factor 2) (EREBP-2) (AtERF2) Length = 243 Score = 35.8 bits (81), Expect = 0.053 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 9/57 (15%) Frame = +1 Query: 238 SLVADQWSESLPFRADDSDDMVVYGALRDAF---------SCGWLPDGSFAAVKPEP 381 S + W LP + +DS+DM+VYG L+DAF SC + F AVK EP Sbjct: 39 SCFTESWG-GLPLKENDSEDMLVYGLLKDAFHFDTSSSDLSCLF----DFPAVKVEP 90
>CARP1_CANAL (P28872) Candidapepsin-1 precursor (EC 3.4.23.24) (Aspartate| protease 1) (ACP 1) (Secreted aspartic protease 1) Length = 391 Score = 29.3 bits (64), Expect = 4.9 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +1 Query: 340 WLPDGSFAAVKPEPLPSPESCYGGFLYPDTPPATSAGDG 456 W+PD S KP P S + C G +Y TS G Sbjct: 89 WVPDASVTCDKPRPGQSADFCKGKGIYTPKSSTTSQNLG 127
>BCL3_MOUSE (Q9Z2F6) B-cell lymphoma 3-encoded protein homolog (Protein Bcl-3)| Length = 440 Score = 28.5 bits (62), Expect = 8.4 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = -2 Query: 365 AAKEPSGSQPQEKASRRAP*TTMSSESSARNGSDSLHWSATRLPKLA 225 A++ SGSQP+ + A T S ESS+R S+ L S + P L+ Sbjct: 349 ASRAASGSQPEPSPDQSA---TNSPESSSRLSSNGLQSSPSSSPSLS 392 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,586,010 Number of Sequences: 219361 Number of extensions: 749285 Number of successful extensions: 3134 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3129 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)