| Clone Name | bast55b01 |
|---|---|
| Clone Library Name | barley_pub |
>MAN1_MOUSE (Q9WU40) Inner nuclear membrane protein Man1 (LEM domain containing| protein 3) (Fragment) Length = 331 Score = 30.8 bits (68), Expect = 1.6 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 3/67 (4%) Frame = -3 Query: 433 RAPVVRQNAPLSPAG*GPYKRGPARW*GVRRPS---RLPPPAESDGAAASGEYGVEAATT 263 RAP A G +R P W G RRP+ PP A SDGAA + + Sbjct: 171 RAPPAPPAAGEVTGGHPGERRKPHSWWGARRPAGPEPQPPAAGSDGAAEDADEELADGED 230 Query: 262 RDGRDEK 242 RD E+ Sbjct: 231 RDPEAEE 237
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 29.3 bits (64), Expect = 4.5 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = +2 Query: 251 SPVSRRRRLHAVLSGSRRAVGLRRWGEPTRPPNSLPSCWPSLVRPL 388 SPV RRRR A LSGS + R P + P S P R L Sbjct: 343 SPVRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRL 388
>IF2_MYCLE (Q9Z5I9) Translation initiation factor IF-2| Length = 924 Score = 29.3 bits (64), Expect = 4.5 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 338 RPPNSLPSCWPSLVRPLPGGREGG 409 RPP PS PS + P PGG GG Sbjct: 194 RPPAPRPSASPSSMSPRPGGAVGG 217
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 29.3 bits (64), Expect = 4.5 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = +2 Query: 251 SPVSRRRRLHAVLSGSRRAVGLRRWGEPTRPPNSLPSCWPSLVRPL 388 SPV RRRR A LSGS + R P + P S P R L Sbjct: 343 SPVRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRL 388
>CO3A1_MOUSE (P08121) Collagen alpha-1(III) chain precursor| Length = 1464 Score = 28.9 bits (63), Expect = 5.9 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = -3 Query: 376 KRGPARW*GVRRPSRLP----PPAESDGAAASGEYGVEAATTRDG 254 +RGP+ + G P+ +P PP E G +G GV RDG Sbjct: 483 ERGPSGFRGPAGPNGIPGEKGPPGERGGPGPAGPRGVAGEPGRDG 527
>LIPA3_MOUSE (P60469) Liprin-alpha-3 (Protein tyrosine phosphatase receptor type| f polypeptide-interacting protein alpha-3) (PTPRF-interacting protein alpha-3) Length = 1043 Score = 28.9 bits (63), Expect = 5.9 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 17/72 (23%) Frame = -3 Query: 439 HARAPVVRQNAPLSPAG*GPYKRGP-ARW*GVRRPS-----------RLPP--PAESDGA 302 +++AP + APL P G G + G RW G + S +PP P E DG+ Sbjct: 367 YSQAPTLPSGAPLDPYGAGSGRAGKRGRWSGAKDESSKDWDRSAPAGSIPPPFPGELDGS 426 Query: 301 ---AASGEYGVE 275 A G +G E Sbjct: 427 DEEEAEGMFGAE 438
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 28.5 bits (62), Expect = 7.7 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 251 SPVSRRRRLHAVLSG-SRRAVGLRRWGEPTRPPNSLPSCWPSLVRPL 388 SPV RRRR A LSG S + R P +PP S P R L Sbjct: 339 SPVRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTVSSPPRKTRRL 385
>PYGO2_HUMAN (Q9BRQ0) Pygopus homolog 2| Length = 406 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 326 GEPTRPPNSLPSCWPSLVRPLPGGREGG 409 G P+ PPN+ P P P PGG +GG Sbjct: 233 GLPSLPPNTSPFPGPDPGFPGPGGEDGG 260
>CCDC8_RAT (P62521) Probable Coiled-coil domain-containing protein 8| Length = 643 Score = 28.5 bits (62), Expect = 7.7 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 328 PPPAESDGAAASGEYGVEAATTR 260 P AE+ GA A+ E+GVEAA ++ Sbjct: 292 PEAAENQGAGAAAEHGVEAAASQ 314
>CO5A1_HUMAN (P20908) Collagen alpha-1(V) chain precursor| Length = 1838 Score = 28.5 bits (62), Expect = 7.7 Identities = 21/55 (38%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Frame = -3 Query: 406 PLSPAG*GPYKRGPARW*GV----RRPSRLPPPAESDGAAASGEYGVEAATTRDG 254 P PAG P +RGPA G RP PP + A GE G + RDG Sbjct: 1082 PPGPAG-SPGERGPAGAAGPIGIPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDG 1135 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,028,677 Number of Sequences: 219361 Number of extensions: 536729 Number of successful extensions: 1857 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1856 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)