ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast55a09 |
|---|---|
| Clone Library Name | barley_pub |
>FPPS_MAIZE (P49353) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 350 Score = 108 bits (271), Expect = 5e-24 Identities = 51/60 (85%), Positives = 54/60 (90%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLKGVDAL 466 FARIY LKEELL DPAF++TE S QWIDRM+DYNVLGGKCNRGLSVVDSYKLLKG DAL Sbjct: 16 FARIYKTLKEELLTDPAFEFTEESRQWIDRMVDYNVLGGKCNRGLSVVDSYKLLKGADAL 75
>FPPS_ARTAN (P49350) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 343 Score = 87.4 bits (215), Expect = 2e-17 Identities = 38/56 (67%), Positives = 47/56 (83%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLKG 454 F ++YD LK EL+ DPAF++ + S QWI++MLDYNV GGK NRGLSVVDSY+LLKG Sbjct: 10 FLKVYDTLKSELINDPAFEFDDDSRQWIEKMLDYNVPGGKLNRGLSVVDSYQLLKG 65
>FPPS2_PARAR (O24242) Farnesyl pyrophosphate synthetase 2 (FPP synthetase 2)| (FPS 2) (Farnesyl diphosphate synthetase 2) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 342 Score = 86.7 bits (213), Expect = 3e-17 Identities = 37/56 (66%), Positives = 47/56 (83%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLKG 454 F ++YD LK EL+ DPAF++ + S QWI++MLDYNV GGK NRGLSV+DSY+LLKG Sbjct: 9 FLQVYDTLKSELINDPAFEFDDDSRQWIEKMLDYNVPGGKLNRGLSVIDSYQLLKG 64
>FPPS_HELAN (O64905) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 341 Score = 86.3 bits (212), Expect = 4e-17 Identities = 39/58 (67%), Positives = 45/58 (77%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLKGVD 460 F +Y LK ELL DPAF++ S QWID+MLDYNV GGK NRGLSVVDSY+LLKG + Sbjct: 9 FLHVYQTLKSELLNDPAFEFHHDSRQWIDKMLDYNVPGGKLNRGLSVVDSYQLLKGAE 66
>FPPS1_PARAR (O24241) Farnesyl pyrophosphate synthetase 1 (FPP synthetase 1)| (FPS 1) (Farnesyl diphosphate synthetase 1) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 342 Score = 86.3 bits (212), Expect = 4e-17 Identities = 36/56 (64%), Positives = 47/56 (83%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLKG 454 F ++YD LK EL+ DPAF++ + S QW+++MLDYNV GGK NRGLSV+DSY+LLKG Sbjct: 9 FLQVYDTLKSELINDPAFEFDDDSRQWVEKMLDYNVPGGKLNRGLSVIDSYQLLKG 64
>FPPS2_ARATH (Q43315) Farnesyl pyrophosphate synthetase 2 (FPP synthetase 2)| (FPS 2) (Farnesyl diphosphate synthetase 2) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 342 Score = 84.7 bits (208), Expect = 1e-16 Identities = 39/61 (63%), Positives = 47/61 (77%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLKGVDAL 466 F +Y LK +LL+DP+F++T S QW++RMLDYNV GGK NRGLSVVDSYKLLK L Sbjct: 8 FLDVYSVLKSDLLQDPSFEFTHESRQWLERMLDYNVRGGKLNRGLSVVDSYKLLKQGQDL 67 Query: 467 T 469 T Sbjct: 68 T 68
>FPPS2_LUPAL (P49352) Farnesyl pyrophosphate synthetase 2 (FPP synthetase 2)| (FPS 2) (Farnesyl diphosphate synthetase 2) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 342 Score = 84.3 bits (207), Expect = 1e-16 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLK 451 F +Y LK ELL+DPAF+++ S QW++RMLDYNV GGK NRGLSV+DSYKLLK Sbjct: 8 FLNVYSILKSELLQDPAFEFSTDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLLK 62
>FPPS1_LUPAL (P49351) Farnesyl pyrophosphate synthetase 1 (FPP synthetase 1)| (FPS 1) (Farnesyl diphosphate synthetase 1) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 342 Score = 84.3 bits (207), Expect = 1e-16 Identities = 37/55 (67%), Positives = 44/55 (80%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLK 451 F +Y LK ELL DPAF+++ S QW+DRMLDYNV GGK NRGLSV+DSY+LLK Sbjct: 8 FLNVYSVLKSELLHDPAFEFSPDSRQWLDRMLDYNVPGGKLNRGLSVIDSYRLLK 62
>FPPS1_ARATH (Q09152) Farnesyl pyrophosphate synthetase 1, mitochondrial| precursor (FPP synthetase 1) (FPS 1) (Farnesyl diphosphate synthetase 1) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 384 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/61 (62%), Positives = 46/61 (75%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLKGVDAL 466 F +Y LK +LL DP+F++T S W+DRMLDYNV GGK NRGLSVVDS+KLLK + L Sbjct: 50 FLNVYSVLKSDLLHDPSFEFTNESRLWVDRMLDYNVRGGKLNRGLSVVDSFKLLKQGNDL 109 Query: 467 T 469 T Sbjct: 110 T 110
>FPPS_KLULA (P49349) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 349 Score = 52.4 bits (124), Expect = 6e-07 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDY--TESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLKGVD 460 F ++ +L +EL RD Y E + +W ++ L+YN GGK NRGLSVVD+Y LLKG Sbjct: 8 FLEVFPSLVQEL-RDILAGYGMPEEAIEWYEKSLNYNTPGGKLNRGLSVVDTYALLKGYK 66 Query: 461 ALT 469 +++ Sbjct: 67 SVS 69
>FPPS_GIBFU (Q92235) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 347 Score = 46.6 bits (109), Expect = 3e-05 Identities = 28/56 (50%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDYTESSHQ--WIDRMLDYNVLGGKCNRGLSVVDSYKLL 448 F +Y L+E LL D A Y Q W R L+ N LGGKCNRG+SV DS LL Sbjct: 10 FNSVYPKLEEALL-DHARSYKLPQEQLDWYKRSLEVNPLGGKCNRGMSVPDSVSLL 64
>FPPS_NEUCR (Q92250) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 347 Score = 46.2 bits (108), Expect = 4e-05 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +2 Query: 287 FARIYDALKEELLR-DPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLKG 454 F ++ L+E LL A+ E W + L+ N LGGKCNRG+SV DS +L G Sbjct: 10 FESVFPKLEEALLEYAKAYKLPEQMLSWYKQSLEVNTLGGKCNRGMSVPDSASILLG 66
>FPPS_YEAST (P08524) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 352 Score = 42.7 bits (99), Expect = 5e-04 Identities = 22/54 (40%), Positives = 31/54 (57%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLL 448 F ++ + L LL A+ + + W L+YN GGK NRGLSVVD+Y +L Sbjct: 16 FPKLVEELNASLL---AYGMPKEACDWYAHSLNYNTPGGKLNRGLSVVDTYAIL 66
>FPPS_SCHPO (O14230) Probable farnesyl pyrophosphate synthetase (FPP| synthetase) (FPS) (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 347 Score = 42.4 bits (98), Expect = 6e-04 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = +2 Query: 362 QWIDRMLDYNVLGGKCNRGLSVVDSYKLLKG 454 +W L +N LGGK NRGLSV+DSY++L G Sbjct: 36 EWYKNSLFHNTLGGKYNRGLSVIDSYEILLG 66
>FPPS_CHICK (P08836) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 367 Score = 38.1 bits (87), Expect = 0.012 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +2 Query: 368 IDRMLDYNVLGGKCNRGLSVVDSYKLLKG 454 + +L YN GGKCNRGL+VV +Y+ L G Sbjct: 59 LKEVLQYNAPGGKCNRGLTVVAAYRELSG 87
>FPPS_MOUSE (Q920E5) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) (Cholesterol-regulated 39 kDa protein) (CR 39) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 353 Score = 34.7 bits (78), Expect = 0.13 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLL 448 F++I L E+ L P + + +L+YN LGGK NRGL+VV +++ L Sbjct: 21 FSQIVKVLTEKELGHPEIGDAIAR---LKEVLEYNALGGKYNRGLTVVQAFQEL 71
>FPPS_RAT (P05369) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) (Cholesterol-regulated 39 kDa protein) (CR 39) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 353 Score = 33.9 bits (76), Expect = 0.22 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +2 Query: 287 FARIYDALKEELLRDPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLL 448 F++I L E+ L P + I +L+YN +GGK NRGL+VV +++ L Sbjct: 21 FSQIVKVLTEDELGHPE---KGDAITRIKEVLEYNTVGGKYNRGLTVVQTFQEL 71
>FPPS_HUMAN (P14324) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 353 Score = 32.3 bits (72), Expect = 0.64 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = +2 Query: 368 IDRMLDYNVLGGKCNRGLSVVDSYKLL 448 + +L+YN +GGK NRGL+VV +++ L Sbjct: 45 LKEVLEYNAIGGKYNRGLTVVVAFREL 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,126,992 Number of Sequences: 219361 Number of extensions: 580694 Number of successful extensions: 1692 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1692 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
