ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast52g02 |
|---|---|
| Clone Library Name | barley_pub |
>GATA6_MOUSE (Q61169) Transcription factor GATA-6 (GATA-binding factor 6)| Length = 444 Score = 30.8 bits (68), Expect = 1.4 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Frame = +3 Query: 102 ATAGPCTPFSTTPVNLPAT--------IPYTPFTAAGPDNGVGGSGCHQVIPSFRRAS 251 A A +++PV +P T +PY +GP N GG+G H P + +AS Sbjct: 28 AAAAAAAAAASSPVYVPTTRVGSMLSGLPYLQGAGSGPSNHAGGAGAH---PGWSQAS 82
>GATA6_RAT (P46153) Transcription factor GATA-6 (GATA-binding factor 6)| (DNA-binding protein GATA-GT2) Length = 441 Score = 30.4 bits (67), Expect = 1.9 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Frame = +3 Query: 102 ATAGPCTPFSTTPVNLPAT--------IPYTPFTAAGPDNGVGGSGCHQVIPSFRRAS 251 A A +++PV +P T +PY +GP N GG+G H P + +AS Sbjct: 28 AAAAAAAAAASSPVYVPTTRVGSMLPGLPYLQGAGSGPSNHAGGAGAH---PGWPQAS 82
>PMPE_CHLMU (Q9PL47) Probable outer membrane protein pmpE precursor| (Polymorphic membrane protein E) Length = 976 Score = 29.6 bits (65), Expect = 3.2 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 314 LPHLAARCLWTWGWRYGAATSPPTGT 391 +PH + LWTWGW A T PT T Sbjct: 614 VPHYGWQGLWTWGW---AKTENPTTT 636
>GATA6_PIG (Q95JA5) Transcription factor GATA-6 (GATA-binding factor 6)| Length = 446 Score = 29.3 bits (64), Expect = 4.1 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Frame = +3 Query: 102 ATAGPCTPFSTTPVNLPAT--------IPYTPFTAAGPDNGVGGSGCHQVIPSFRRAS 251 A A +++PV +P T +PY +GP N GG+G H P + +AS Sbjct: 28 AAAAAAAAAASSPVYVPTTRVGSMLPGLPYLQGAGSGPANHAGGAGSH---PGWPQAS 82
>BARH1_RAT (P63156) BarH-like 1 homeobox protein (Bar-class homeodomain| protein MBH2) (BarH-related homeobox protein 1) Length = 327 Score = 29.3 bits (64), Expect = 4.1 Identities = 24/56 (42%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +2 Query: 215 LPPGDPLLPPCI*CEWSSVLTLSERKTSRHRLCLPHLAAR-CLWTWGWRYGAATSP 379 LP GDPLL C S L LS R S P R CL T R GAA+ P Sbjct: 22 LPKGDPLLGDC-----RSPLELSPRSESSSDCSSPASPGRDCLETSTSRPGAASGP 72
>BARH1_MOUSE (P63157) BarH-like 1 homeobox protein (Bar-class homeodomain| protein MBH2) (BarH-related homeobox protein 1) Length = 327 Score = 29.3 bits (64), Expect = 4.1 Identities = 24/56 (42%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +2 Query: 215 LPPGDPLLPPCI*CEWSSVLTLSERKTSRHRLCLPHLAAR-CLWTWGWRYGAATSP 379 LP GDPLL C S L LS R S P R CL T R GAA+ P Sbjct: 22 LPKGDPLLGDC-----RSPLELSPRSESSSDCSSPASPGRDCLETSTSRPGAASGP 72
>MUC2_HUMAN (Q02817) Mucin-2 precursor (Intestinal mucin 2)| Length = 5179 Score = 29.3 bits (64), Expect = 4.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 96 PLATAGPCTPFSTTPVNLPATIPYTPFTAAGP 191 PL T P P STT P T P P T P Sbjct: 1448 PLPTTTPSPPISTTTTPPPTTTPSPPTTTPSP 1479
>GABR2_RAT (O88871) Gamma-aminobutyric acid type B receptor, subunit 2| precursor (GABA-B receptor 2) (GABA-B-R2) (Gb2) (GABABR2) (G-protein coupled receptor 51) Length = 940 Score = 29.3 bits (64), Expect = 4.1 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = +2 Query: 305 RLCLPHLAARCLW----TWGWRYGAATSPPT 385 RL LP L + LW WGW GA PP+ Sbjct: 21 RLLLPLLLSLLLWLAPGAWGWTRGAPRPPPS 51
>HMDH1_ORYSA (P48019) 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (EC| 1.1.1.34) (HMG-CoA reductase 1) Length = 509 Score = 28.9 bits (63), Expect = 5.4 Identities = 20/67 (29%), Positives = 28/67 (41%) Frame = -1 Query: 356 ATPMSRGTVLLDEADRAGDGMSSSPTV*APMTTRIRCTAEGGDHLVAARSADAIVGACRS 177 A P + T D+ D G ++P APM EG D + A A + + R Sbjct: 53 AHPDAPATTTGDDDDGQGGSRRAAPPEPAPMHGHGGGMMEGDDEEIVAAVASGALPSHRL 112 Query: 176 EWGIGDC 156 E +GDC Sbjct: 113 ESRLGDC 119
>POLG_HCVH (P27958) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/NT Length = 3010 Score = 28.5 bits (62), Expect = 7.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 247 ARRKEGITWWQPDPPTPLSG 188 ARR EG TW QP P PL G Sbjct: 67 ARRPEGRTWAQPGYPWPLYG 86
>POLG_HCV1 (P26664) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/NT Length = 3010 Score = 28.5 bits (62), Expect = 7.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 247 ARRKEGITWWQPDPPTPLSG 188 ARR EG TW QP P PL G Sbjct: 67 ARRPEGRTWAQPGYPWPLYG 86
>POLG_HCVJA (P26662) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 28.5 bits (62), Expect = 7.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 247 ARRKEGITWWQPDPPTPLSG 188 ARR EG TW QP P PL G Sbjct: 67 ARRPEGRTWAQPGYPWPLYG 86
>POLG_HCVBK (P26663) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 28.5 bits (62), Expect = 7.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 247 ARRKEGITWWQPDPPTPLSG 188 ARR EG TW QP P PL G Sbjct: 67 ARRPEGRTWAQPGYPWPLYG 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,611,793 Number of Sequences: 219361 Number of extensions: 1128197 Number of successful extensions: 3535 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 3357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3534 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
