| Clone Name | bast52f11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SERR_DROME (P18168) Serrate protein precursor (Protein beaded) | 28 | 6.8 |
|---|
>SERR_DROME (P18168) Serrate protein precursor (Protein beaded)| Length = 1404 Score = 28.1 bits (61), Expect = 6.8 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = -2 Query: 161 RARTRPISSSPSMAFASGAGDAEP*LNPNPLLAASSGSCNLALRGEPCVRGCE 3 R T P+ S S A A E LNP P LAAS+ S + R +P C+ Sbjct: 1280 RRYTNPLKGSTSSLRA--ATGMELSLNPAPELAASAASSSALHRSQPLFPPCD 1330 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.308 0.124 0.316 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,350,628 Number of Sequences: 219361 Number of extensions: 275568 Number of successful extensions: 502 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)