| Clone Name | bast52e12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CYSKP_CAPAN (P31300) Cysteine synthase, chloroplast precursor (E... | 30 | 1.0 | 2 | ILVB_ECOLI (P08142) Acetolactate synthase isozyme I large subuni... | 28 | 6.8 |
|---|
>CYSKP_CAPAN (P31300) Cysteine synthase, chloroplast precursor (EC 2.5.1.47)| (O-acetylserine sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase B) (CS-B) (OAS-TL B) Length = 374 Score = 30.4 bits (67), Expect = 1.0 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +1 Query: 10 NPTQPNHLAPFRSMASLLLKGVHKRLGLPSI---SISCSSADATNI 138 N +PN + RS SL+ V++++G PS+ ++S + T I Sbjct: 17 NKCEPNRICSLRSQQSLVFDNVNRKVGFPSVVCKAVSVQTKSPTEI 62
>ILVB_ECOLI (P08142) Acetolactate synthase isozyme I large subunit (EC 2.2.1.6)| (AHAS-I) (Acetohydroxy-acid synthase I large subunit) (ALS-I) Length = 562 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +1 Query: 16 TQPNH-LAPFRSMASLLLKGVHKRLGLPSISISCSSADATNII 141 TQ H LA A + +G+ + G P++ ++CS ATN++ Sbjct: 50 TQIRHILARHEQGAGFIAQGMARTDGKPAVCMACSGPGATNLV 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.128 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,496,247 Number of Sequences: 219361 Number of extensions: 384860 Number of successful extensions: 1355 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1353 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)