| Clone Name | bast52b03 |
|---|---|
| Clone Library Name | barley_pub |
>MYST3_RAT (Q5TKR9) Histone acetyltransferase MYST3 (EC 2.3.1.48) (EC 2.3.1.-)| (MYST protein 3) (MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3) (Monocytic leukemia zinc finger protein) (Monocytic leukemia zinc finger homolog) Length = 1998 Score = 31.6 bits (70), Expect = 0.80 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 106 PMLQEDEEGPLQDPRQDEHQDHLFRREEQ 192 P +E+EE PL DPRQ E + +EQ Sbjct: 1263 PEAEEEEEKPLDDPRQSEEEPQELEEQEQ 1291
>NU5M_MYXGL (Q9G2W8) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 601 Score = 29.3 bits (64), Expect = 3.9 Identities = 21/44 (47%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -3 Query: 291 LPLTCISLITRPASQQSFLHS--LSASNGPDTVTALLFSSKEMV 166 LPL I L S Q LH LSA GP V+ALL SS +V Sbjct: 210 LPLLGIVLAATGKSAQFMLHPWLLSAMEGPTPVSALLHSSTMVV 253
>FPG_LACAC (Q5FIV8) Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)| (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (EC 4.2.99.18) (AP lyase mutM) Length = 275 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 265 HPAGLAAELPAQLVGVERPGHRHGIALLVERDGLDVHLVLD 143 HP +A ++PA+ V IAL +E+ G VH LD Sbjct: 185 HPLSIANKIPAKKVAGLWENINQTIALAIEKRGTTVHSYLD 225
>SNPC2_RAT (Q68FX5) snRNA-activating protein complex subunit 2 (SNAPc subunit| 2) (snRNA-activating protein complex 45 kDa subunit) (SNAPc 45 kDa subunit) (Small nuclear RNA-activating complex polypeptide 2) Length = 359 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 199 HGIALLVERDGLDVHLVLDLAEDLPHLP 116 HG L + ++L++ LAE+LPHLP Sbjct: 244 HGPELSAVESAVVLNLLMSLAEELPHLP 271
>KR10B_HUMAN (P60412) Keratin-associated protein 10-11 (Keratin-associated| protein 10.11) (High sulfur keratin-associated protein 10.11) (Keratin-associated protein 18-11) (Keratin-associated protein 18.11) Length = 298 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 297 CSLPLTCISLITRPASQQSFLHSL 226 C P +C+SL+ RPAS + +SL Sbjct: 267 CCCPASCVSLLCRPASSRLACYSL 290
>R1A10_SOLDE (Q60CZ8) Putative late blight resistance protein homolog R1A-10| Length = 1306 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 155 MNIKTISFDEKSNAVTVSGPFDADKL 232 + I+++S DEK +TV+G DAD++ Sbjct: 1266 LGIESVSSDEKEKKLTVTGDVDADEV 1291
>PANC_RHIME (Q92NN0) Pantoate--beta-alanine ligase (EC 6.3.2.1) (Pantothenate| synthetase) (Pantoate-activating enzyme) Length = 291 Score = 28.1 bits (61), Expect = 8.8 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 15/79 (18%) Frame = -2 Query: 244 ELPAQLVGVERPGHRHGIALLV---------------ERDGLDVHLVLDLAEDLPHLPVA 110 +L ++L G RPGH G+A +V E+D + ++ + EDL Sbjct: 111 KLGSELEGAVRPGHFAGVATVVTKLFNIVQPDRAYFGEKDFQQLQIIRRMVEDLAQPVTV 170 Query: 109 SGVFKVNFEDNRGDLVRHV 53 GV V ED R+V Sbjct: 171 IGVPTVREEDGLACSSRNV 189 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,044,920 Number of Sequences: 219361 Number of extensions: 646296 Number of successful extensions: 2600 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2600 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)