| Clone Name | bast52a12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYE_HALMA (Q5V5N9) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Gluta... | 30 | 4.4 |
|---|
>SYE_HALMA (Q5V5N9) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 579 Score = 29.6 bits (65), Expect = 4.4 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +3 Query: 15 PQIPSPPL--SCQPRRRRDRSMGSSVDVIPDWVGDSGESVGPVDYGCVRRCR 164 P PPL + R RR+ + S V V D + D G+ + YGCVR R Sbjct: 443 PDAGEPPLHPDYEERGRREIPVTSGVVVEGDDLPDHGDRIWLKGYGCVRHTR 494 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.125 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,432,498 Number of Sequences: 219361 Number of extensions: 746283 Number of successful extensions: 2835 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2830 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)