| Clone Name | bast52a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YFK5_SCHPO (P87132) Hypothetical protein C167.05 in chromosome I | 36 | 0.051 | 2 | IMPX_YEAST (P32351) Sugar utilization regulatory protein IMP2 | 29 | 8.2 |
|---|
>YFK5_SCHPO (P87132) Hypothetical protein C167.05 in chromosome I| Length = 601 Score = 36.2 bits (82), Expect = 0.051 Identities = 18/47 (38%), Positives = 28/47 (59%) Frame = +3 Query: 6 FSSLAASSSPHRRIAIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHV 146 F + A+SS + + +DLS ES A +WAV LR GD ++++ V Sbjct: 420 FQTAASSSKRNCTYFLTLDLSSESLHAAEWAVGILLRNGDTLIIVDV 466
>IMPX_YEAST (P32351) Sugar utilization regulatory protein IMP2| Length = 346 Score = 28.9 bits (63), Expect = 8.2 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +3 Query: 21 ASSSPHRRIAIAVDLSDESAFAVKWAVQNYLRPGDAVVLLHVRPT 155 A + R + DLS ES +A+ + + + GD V ++H P+ Sbjct: 204 AEAGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTVYIVHWEPS 248 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,894,747 Number of Sequences: 219361 Number of extensions: 418225 Number of successful extensions: 1352 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1352 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)