ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast52a04 |
|---|---|
| Clone Library Name | barley_pub |
>NMT1_ARATH (Q9LTR9) Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97)| (Peptide N-myristoyltransferase 1) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase 1) Length = 434 Score = 66.6 bits (161), Expect = 2e-11 Identities = 32/59 (54%), Positives = 39/59 (66%) Frame = +1 Query: 46 PAAPEDTSIEAQARRVQEHMTLASNPTTRRHKFWETQPVGQFGDVADVSLPDGAIEPPT 222 P +DTS+E RR Q+ M+ A + HKFWETQPVGQF D+ D SLP+G IEP T Sbjct: 23 PLVKDDTSLETIVRRFQDSMSEA-----KTHKFWETQPVGQFKDIGDTSLPEGPIEPAT 76
>NMT2_ARATH (Q94L32) Probable glycylpeptide N-tetradecanoyltransferase 2 (EC| 2.3.1.97) (Peptide N-myristoyltransferase 2) (Myristoyl-CoA:protein N-myristoyltransferase 2) (NMT 2) (Type I N-myristoyltransferase 2) Length = 430 Score = 51.2 bits (121), Expect = 7e-07 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = +1 Query: 127 TRRHKFWETQPVGQFGDVADVSLPDGAIEPPT 222 ++ HKFWETQPV QF D+ D SLP+G IEP T Sbjct: 44 SKTHKFWETQPVEQFKDIQDTSLPEGPIEPAT 75
>NMT2_MOUSE (O70311) Glycylpeptide N-tetradecanoyltransferase 2 (EC 2.3.1.97)| (Peptide N-myristoyltransferase 2) (Myristoyl-CoA:protein N-myristoyltransferase 2) (NMT 2) (Type II N-myristoyltransferase) Length = 529 Score = 31.6 bits (70), Expect = 0.58 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +1 Query: 124 TTRRHKFWETQPVGQFGDVADVSLPDGAIEP 216 T RR++FW+TQPV + +V GAIEP Sbjct: 146 TKRRYQFWDTQPVPKLNEVI---TSHGAIEP 173
>NMT_CRYNV (P34809) Glycylpeptide N-tetradecanoyltransferase (EC 2.3.1.97)| (Peptide N-myristoyltransferase) (Myristoyl-CoA:protein N-myristoyltransferase) (NMT) Length = 491 Score = 31.2 bits (69), Expect = 0.76 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +1 Query: 136 HKFWETQPVGQF-GDVADVSLPDGAIEPP 219 HKFW+TQPV Q G A + +G I+ P Sbjct: 45 HKFWKTQPVPQITGSGASAPMEEGPIDDP 73
>NMT_CRYNE (Q5K7E9) Glycylpeptide N-tetradecanoyltransferase (EC 2.3.1.97)| (Peptide N-myristoyltransferase) (Myristoyl-CoA:protein N-myristoyltransferase) (NMT) Length = 493 Score = 30.8 bits (68), Expect = 0.99 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +1 Query: 136 HKFWETQPVGQF-GDVADVSLPDGAIEPP 219 HKFW+TQPV Q G A + +G I+ P Sbjct: 45 HKFWKTQPVPQITGSGAPAPIEEGPIDDP 73
>NMT_ASHGO (Q75EK2) Glycylpeptide N-tetradecanoyltransferase (EC 2.3.1.97)| (Peptide N-myristoyltransferase) (Myristoyl-CoA:protein N-myristoyltransferase) (NMT) Length = 452 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 103 MTLASNPTTRRHKFWETQPVGQFGDVADVSLPDGAIEPP 219 +T +KFW+TQPV +F + + +G I PP Sbjct: 27 LTQQQRKAFEEYKFWKTQPVARFDEKVE---EEGPINPP 62
>NMT1_RAT (Q8K1Q0) Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97)| (Peptide N-myristoyltransferase 1) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase) Length = 496 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 130 RRHKFWETQPVGQFGDVADVSLPDGAIEP 216 R ++FW+TQPV + G+V + G +EP Sbjct: 115 RSYQFWDTQPVPKLGEVVNT---HGPVEP 140
>NMT1_PONPY (Q5RAF3) Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97)| (Peptide N-myristoyltransferase 1) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase) Length = 496 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 130 RRHKFWETQPVGQFGDVADVSLPDGAIEP 216 R ++FW+TQPV + G+V + G +EP Sbjct: 115 RSYQFWDTQPVPKLGEVVNT---HGPVEP 140
>NMT1_MOUSE (O70310) Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97)| (Peptide N-myristoyltransferase 1) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase) Length = 496 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 130 RRHKFWETQPVGQFGDVADVSLPDGAIEP 216 R ++FW+TQPV + G+V + G +EP Sbjct: 115 RSYQFWDTQPVPKLGEVVNT---HGPVEP 140
>NMT1_HUMAN (P30419) Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97)| (Peptide N-myristoyltransferase 1) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase) Length = 496 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 130 RRHKFWETQPVGQFGDVADVSLPDGAIEP 216 R ++FW+TQPV + G+V + G +EP Sbjct: 115 RSYQFWDTQPVPKLGEVVNT---HGPVEP 140
>NMT1_BOVIN (P31717) Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97)| (Peptide N-myristoyltransferase 1) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase) Length = 497 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 130 RRHKFWETQPVGQFGDVADVSLPDGAIEP 216 R ++FW+TQPV + G+V + G +EP Sbjct: 115 RSYQFWDTQPVPKLGEVVNT---HGPVEP 140
>NMT_AJECA (P34763) Glycylpeptide N-tetradecanoyltransferase (EC 2.3.1.97)| (Peptide N-myristoyltransferase) (Myristoyl-CoA:protein N-myristoyltransferase) (NMT) Length = 529 Score = 29.3 bits (64), Expect = 2.9 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 4/39 (10%) Frame = +1 Query: 109 LASNPTTRRH----KFWETQPVGQFGDVADVSLPDGAIE 213 L+ NP ++ KFW+TQPV +F D S PDG I+ Sbjct: 105 LSVNPKNQKDMASFKFWQTQPVIRFDDRESES-PDGPIK 142
>NMT_GIBZE (Q4I061) Glycylpeptide N-tetradecanoyltransferase (EC 2.3.1.97)| (Peptide N-myristoyltransferase) (Myristoyl-CoA:protein N-myristoyltransferase) (NMT) Length = 564 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +1 Query: 136 HKFWETQPVGQFGDVADVSLPDGAI 210 +KFW+TQPV +FG+ D +L +G + Sbjct: 153 YKFWQTQPVPKFGE--DNNLQEGPL 175
>NMT_SCHPO (O43010) Glycylpeptide N-tetradecanoyltransferase (EC 2.3.1.97)| (Peptide N-myristoyltransferase) (Myristoyl-CoA:protein N-myristoyltransferase) (NMT) Length = 466 Score = 28.5 bits (62), Expect = 4.9 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 91 VQEHMTLASNPTTRRHKFWETQPVGQFGDVADVSLPDGAIEPPT 222 +++ A T KFW+TQPV +F D +G I+P T Sbjct: 36 IEKEEAAAPPKTYEDFKFWKTQPVPKFDDEC---TQEGPIDPNT 76
>GP46_LEIAM (P21978) Surface membrane glycoprotein GP46/M-2 precursor| Length = 476 Score = 28.5 bits (62), Expect = 4.9 Identities = 18/51 (35%), Positives = 21/51 (41%) Frame = -2 Query: 155 CVSQNLWRRVVGLEARVMCSCTRRACASMEVSSGAAGAPSLVEALAHGAGG 3 C+ + WRR G+E C C CA V GA G L GA G Sbjct: 289 CLGEPRWRRGGGVERTAGCRCCVGGCA---VERGAGGVRVRRAPLLCGAPG 336
>NMT_DEBHA (Q6BJF4) Glycylpeptide N-tetradecanoyltransferase (EC 2.3.1.97)| (Peptide N-myristoyltransferase) (Myristoyl-CoA:protein N-myristoyltransferase) (NMT) Length = 451 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 97 EHMTLASNPTTRRHKFWETQPVGQFGDVADVSLPDGAIEPP 219 E +T + +KFW+TQPV F + D P + P Sbjct: 24 ESLTEPQQKQMKDYKFWKTQPVPSFDEKIDSEGPIDQTKTP 64
>NMT2_HUMAN (O60551) Glycylpeptide N-tetradecanoyltransferase 2 (EC 2.3.1.97)| (Peptide N-myristoyltransferase 2) (Myristoyl-CoA:protein N-myristoyltransferase 2) (NMT 2) (Type II N-myristoyltransferase) Length = 498 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 133 RHKFWETQPVGQFGDVADVSLPDGAIEP 216 R++FW+TQPV + +V GAIEP Sbjct: 118 RYQFWDTQPVPKLDEVI---TSHGAIEP 142 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.129 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,059,818 Number of Sequences: 219361 Number of extensions: 257284 Number of successful extensions: 868 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)
