| Clone Name | bast50e03 |
|---|---|
| Clone Library Name | barley_pub |
>PI4KA_HUMAN (P42356) Phosphatidylinositol 4-kinase alpha (EC 2.7.1.67)| (PI4-kinase alpha) (PtdIns-4-kinase alpha) (PI4K-alpha) Length = 2044 Score = 29.6 bits (65), Expect = 2.9 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +2 Query: 146 NQSPAAPTISPAELVRIKNSIRSAATPPDELAALFLK-GIPHTPFLGDRSIFSLAVSRLT 322 N + T++PAEL ++++I + PP E++AL K + +L S++ L R+ Sbjct: 790 NSAMKNDTVTPAELSELRSTIINLLDPPPEVSALINKLDFAMSTYL--LSVYRLEYMRVL 847 Query: 323 AAARPD 340 + PD Sbjct: 848 RSTDPD 853
>SHAN3_RAT (Q9JLU4) SH3 and multiple ankyrin repeat domains 3 (Shank3)| (Proline-rich synapse associated protein 2) (ProSAP2) (SPANK-2) Length = 1815 Score = 29.3 bits (64), Expect = 3.8 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +2 Query: 137 STQNQSPAAPTISPAELVRIKNSIRSAATPPDELAALFLKGIPHTPFLG-DRSIFSLAVS 313 +T Q P + I+PAE+ + R P++L KGIP T +G D + SL Sbjct: 812 ATVKQRPTSRRITPAEISSLFE--RQGLPGPEKLPGSLRKGIPRTKSVGEDEKLASLLEG 869 Query: 314 R 316 R Sbjct: 870 R 870
>CM35H_HUMAN (Q9UGN4) CMRF35-H antigen precursor (CMRF35-H9) (CMRF-35-H9)| (CD300a antigen) (Inhibitory receptor protein 60) (IRp60) (IRC1/IRC2) (NK inhibitory receptor) Length = 299 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 155 PAAPTISPAELVRIKNSIRSAATPPDELAALFLKGIPHT 271 PA+ +++PA + K S + A PP LF G H+ Sbjct: 126 PASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHS 164
>AP1G2_HUMAN (O75843) AP-1 complex subunit gamma-2 (Adapter-related protein| complex 1 gamma-2 subunit) (Gamma2-adaptin) (Adaptor protein complex AP-1 gamma-2 subunit) (G2ad) Length = 785 Score = 28.5 bits (62), Expect = 6.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 1 IALIDLACPPPPSKPFPD 54 + L+DL C PPP P PD Sbjct: 652 VHLLDLPCVPPPPAPIPD 669
>OSBL7_HUMAN (Q9BZF2) Oxysterol-binding protein-related protein 7 (OSBP-related| protein 7) (ORP-7) Length = 842 Score = 28.1 bits (61), Expect = 8.6 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +2 Query: 227 PDELAALFLKGIPHTPFLGDRSIFSLAVS 313 P+E AL++KG TP L SI SLA S Sbjct: 371 PEEQEALYMKGRELTPQLSQTSILSLADS 399 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.147 0.489 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,860,700 Number of Sequences: 219361 Number of extensions: 250979 Number of successful extensions: 881 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)