| Clone Name | bast50b11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CD4_RABIT (P46630) T-cell surface glycoprotein CD4 precursor (T-... | 30 | 2.8 | 2 | VNUA_PRVKA (P33485) Probable nuclear antigen | 30 | 3.7 | 3 | SP15_STRGR (P19471) 55.5 kDa and 49.5 kDa sporulation proteins (... | 29 | 6.3 | 4 | HSF24_LYCPE (P22335) Heat shock factor protein HSF24 (Heat shock... | 29 | 6.3 | 5 | KCNQ1_HUMAN (P51787) Potassium voltage-gated channel subfamily K... | 28 | 8.2 |
|---|
>CD4_RABIT (P46630) T-cell surface glycoprotein CD4 precursor (T-cell surface| antigen T4/Leu-3) Length = 459 Score = 30.0 bits (66), Expect = 2.8 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = +3 Query: 24 PFALYSPADPRAEQERAIDPPVQSARSVKAAASFPAGAWVLVLGFLTASSKGFWPASNSP 203 P A + R + ++ P QS++ + ++ V +LG +SS FW NSP Sbjct: 20 PAATWGKTVVRGKAGAIVELPCQSSQKRNSVFNWKHANQVKILGNQGSSSSSFWLKGNSP 79 Query: 204 L 206 L Sbjct: 80 L 80
>VNUA_PRVKA (P33485) Probable nuclear antigen| Length = 1733 Score = 29.6 bits (65), Expect = 3.7 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -1 Query: 139 QAPAGKEAAALTDRAD*TGGSIARSCSARGSAGE*RAKGRQGGGRS 2 + P + LTDR GG R C G AG +G GGGR+ Sbjct: 1626 RGPRPRRRPGLTDRVPPRGGPSPRGCRGAGRAGG-GGRGGCGGGRA 1670
>SP15_STRGR (P19471) 55.5 kDa and 49.5 kDa sporulation proteins (ORF1590 and| ORF1422) Length = 529 Score = 28.9 bits (63), Expect = 6.3 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 60 EQERAIDPPVQSARSVKAAASFPAGAWVLVLGFLTASSKGF 182 +QE A +Q+ R +AAA P G +VL L A+ +GF Sbjct: 303 QQEAAQRYYIQALRLARAAADVPLGGYVLASMSLQATYRGF 343
>HSF24_LYCPE (P22335) Heat shock factor protein HSF24 (Heat shock transcription| factor 24) (HSTF 24) (Heat stress transcription factor) Length = 301 Score = 28.9 bits (63), Expect = 6.3 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 7/63 (11%) Frame = -1 Query: 223 RRVAPHRGEF-----DAGQNPFEDAVRKPKTSTQAPAGKE--AAALTDRAD*TGGSIARS 65 R++ P + EF GQ A+R+ KT T PAG + AA + D +G I S Sbjct: 71 RKIVPDKWEFANENFKRGQKELLTAIRRRKTVTSTPAGGKSVAAGASASPDNSGDDIGSS 130 Query: 64 CSA 56 ++ Sbjct: 131 STS 133
>KCNQ1_HUMAN (P51787) Potassium voltage-gated channel subfamily KQT member 1| (Voltage-gated potassium channel subunit Kv7.1) (IKs producing slow voltage-gated potassium channel alpha subunit KvLQT1) (KQT-like 1) Length = 676 Score = 28.5 bits (62), Expect = 8.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 137 GPSRKGGCSLNRPSGLNGRIDRSLLL 60 GP R+GG + +P G G +D L L Sbjct: 629 GPPREGGAHITQPCGSGGSVDPELFL 654 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,167,098 Number of Sequences: 219361 Number of extensions: 867510 Number of successful extensions: 3738 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3729 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)