| Clone Name | bast50b09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YYAP1_HUMAN (Q9H869) YY1-associated protein 1 (Hepatocellular ca... | 29 | 3.7 | 2 | Y495_MYCBO (P64706) Hypothetical protein Mb0495 | 28 | 6.4 | 3 | Y485_MYCTU (P64705) Hypothetical protein Rv0485/MT0503 | 28 | 6.4 |
|---|
>YYAP1_HUMAN (Q9H869) YY1-associated protein 1 (Hepatocellular carcinoma| susceptibility protein) (Hepatocellular carcinoma-associated protein 2) Length = 796 Score = 28.9 bits (63), Expect = 3.7 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 114 ATGPGSRVTRYAKSTAASVTPVRPGKTHELSA 209 AT PGSR+TR+ + V PGK L+A Sbjct: 11 ATNPGSRLTRWPPPDKQEGSAVDPGKRRSLAA 42
>Y495_MYCBO (P64706) Hypothetical protein Mb0495| Length = 438 Score = 28.1 bits (61), Expect = 6.4 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 193 VLPGRTGVTDAAVDLAYRVTRLPGPVARPVAVG 95 V+P ++D+A +R RL GPV R V G Sbjct: 27 VMPPSLHLSDSAAASVFRAVRLRGPVGRDVIAG 59
>Y485_MYCTU (P64705) Hypothetical protein Rv0485/MT0503| Length = 438 Score = 28.1 bits (61), Expect = 6.4 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 193 VLPGRTGVTDAAVDLAYRVTRLPGPVARPVAVG 95 V+P ++D+A +R RL GPV R V G Sbjct: 27 VMPPSLHLSDSAAASVFRAVRLRGPVGRDVIAG 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.130 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,276,449 Number of Sequences: 219361 Number of extensions: 305092 Number of successful extensions: 1242 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1242 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)