| Clone Name | bast50b07 |
|---|---|
| Clone Library Name | barley_pub |
>KCNN3_PIG (P58392) Small conductance calcium-activated potassium channel| protein 3 (SK3) Length = 724 Score = 35.0 bits (79), Expect = 0.090 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 12/55 (21%) Frame = +3 Query: 258 LQLHQEVQQDQEPPPAPVFQLSHLQAASV------------RQPGSSAEYALLAP 386 LQL Q+ QQ Q+ PP P+ QL+ LQ+ V R P SS A+L P Sbjct: 61 LQLQQQQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAILHP 115
>BARH1_DROAN (P22544) Homeobox protein B-H1 (Homeobox BarH1 protein)| Length = 606 Score = 32.0 bits (71), Expect = 0.76 Identities = 19/48 (39%), Positives = 21/48 (43%) Frame = +3 Query: 243 HHYRLLQLHQEVQQDQEPPPAPVFQLSHLQAASVRQPGSSAEYALLAP 386 HHY L Q HQ+ QQ Q P P V V GS+ A L P Sbjct: 42 HHYSLQQQHQQQQQQQPPAPPAV-----ATTTVVNMSGSTTTAANLKP 84
>NONO_MOUSE (Q99K48) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 473 Score = 30.4 bits (67), Expect = 2.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 240 HHHYRLLQLHQEVQQDQEPPPAP 308 HHH + Q Q+ QQ Q PPP P Sbjct: 22 HHHQQHHQQQQQQQQQQPPPPIP 44 Score = 28.9 bits (63), Expect = 6.4 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 240 HHHYRLLQLHQEVQQDQEPPPAPVFQLSHLQAAS 341 HH + Q HQ+ QQ Q+ P P + QA+S Sbjct: 19 HHQHHHQQHHQQQQQQQQQQPPPPIPANGQQASS 52
>ATX2_HUMAN (Q99700) Ataxin-2 (Spinocerebellar ataxia type 2 protein)| (Trinucleotide repeat-containing gene 13 protein) Length = 1312 Score = 30.0 bits (66), Expect = 2.9 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +3 Query: 261 QLHQEVQQDQEPPPAPVFQLSHLQAASVRQPGSS 362 Q Q+ QQ Q+PPPA AA+VR+PG S Sbjct: 177 QQQQQQQQQQQPPPA---------AANVRKPGGS 201
>HLX1_HUMAN (Q14774) Homeobox protein HLX1 (Homeobox protein HB24)| Length = 488 Score = 30.0 bits (66), Expect = 2.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 240 HHHYRLLQLHQEVQQDQEPPPAP 308 HHH+ Q Q+ Q Q+PPP P Sbjct: 120 HHHHPQQQQQQQQPQQQQPPPPP 142
>RANB3_MOUSE (Q9CT10) Ran-binding protein 3 (RanBP3)| Length = 491 Score = 30.0 bits (66), Expect = 2.9 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = +3 Query: 246 HYRLLQLHQEVQQDQE---PPPAPVFQLSHLQAASVRQPGSSAEYALLAPMG 392 H+R+L L +Q+QE PPP P A + S E A+LAP G Sbjct: 429 HHRILALRSRAEQEQEAKAPPPEP-------GATRATEEEDSDEDAVLAPSG 473
>OSA_DROME (Q8IN94) Trithorax group protein osa (Protein eyelid)| Length = 2716 Score = 29.6 bits (65), Expect = 3.8 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +3 Query: 240 HHHYRLLQLHQEVQQDQEPPPAPVFQLSHLQAASVRQPGSSAEYA 374 H+H+ LHQ QQ Q PPP + Q H + PG + E+A Sbjct: 92 HYHH----LHQ--QQQQHPPPPHMQQQQHHGGPAPPPPGGAPEHA 130
>PHLPP_HUMAN (O60346) PH domain leucine-rich repeat-containing protein phosphatase| (EC 3.1.3.16) (PH domain leucine-rich repeat protein phosphatase) (Pleckstrin homology domain-containing family E protein 1) (Suprachiasmatic nucleus circadian oscillatory Length = 1717 Score = 29.6 bits (65), Expect = 3.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 255 LLQLHQEVQQDQEPPPAPVFQ 317 +++ HQE QQ Q+PPP P Q Sbjct: 1677 IMKHHQEQQQQQQPPPPPQLQ 1697
>PO6F2_MOUSE (Q8BJI4) POU domain, class 6, transcription factor 2| Length = 691 Score = 29.3 bits (64), Expect = 4.9 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 261 QLHQEVQQDQEPPPAPVFQLSHLQAASVRQPGS 359 Q Q+ QQ Q+PPP P Q H Q AS P S Sbjct: 188 QQQQQQQQQQQPPPPPTSQ--HPQPASQAPPQS 218
>PIP2_PEA (P25794) Probable aquaporin PIP-type 7a (Turgor-responsive protein| 7a) (Turgor-responsive protein 31) Length = 289 Score = 29.3 bits (64), Expect = 4.9 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 261 QLHQEVQQDQEPPPAPVFQLSHLQAASVRQPG 356 Q E + QEPPPAP+F+ S L + S + G Sbjct: 26 QSQDEPKDYQEPPPAPLFEPSELTSWSFYRAG 57
>NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 471 Score = 29.3 bits (64), Expect = 4.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 240 HHHYRLLQLHQEVQQDQEPPPAP 308 H H+ Q HQ+ QQ PPP P Sbjct: 20 HQHHHQQQHHQQQQQQPPPPPIP 42
>NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding protein (NonO| protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) Length = 471 Score = 29.3 bits (64), Expect = 4.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 240 HHHYRLLQLHQEVQQDQEPPPAP 308 H H+ Q HQ+ QQ PPP P Sbjct: 20 HQHHHQQQHHQQQQQQPPPPPIP 42 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,576,962 Number of Sequences: 219361 Number of extensions: 495803 Number of successful extensions: 1817 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1776 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)