| Clone Name | bast50b05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RAD9A_HUMAN (Q99638) Cell cycle checkpoint control protein RAD9A... | 30 | 2.3 | 2 | ROM1_YEAST (P53046) RHO1 GDP-GTP exchange protein 1 (Protein kin... | 30 | 3.1 | 3 | GAG_IPMA (P11365) Retrovirus-related Gag polyprotein [Contains: ... | 30 | 4.0 | 4 | VRP1_YEAST (P37370) Verprolin | 30 | 4.0 | 5 | COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component... | 29 | 6.8 |
|---|
>RAD9A_HUMAN (Q99638) Cell cycle checkpoint control protein RAD9A (EC 3.1.11.2)| (DNA repair exonuclease rad9 homolog A) (hRAD9) Length = 391 Score = 30.4 bits (67), Expect = 2.3 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Frame = -1 Query: 445 PDRPDKTGPWSQKE-----GTCPASDPRNK*NNVKSSGISLAPVRAPTYPTPL 302 P P GP S++E T P + P K ++ I LAPVR+P P+P+ Sbjct: 331 PQPPKSPGPHSEEEDEAEPSTVPGTPPPKKFRSLFFGSI-LAPVRSPQGPSPV 382
>ROM1_YEAST (P53046) RHO1 GDP-GTP exchange protein 1 (Protein kinase C| suppressor SKC1) Length = 1155 Score = 30.0 bits (66), Expect = 3.1 Identities = 29/115 (25%), Positives = 46/115 (40%), Gaps = 13/115 (11%) Frame = -1 Query: 358 KSSGISLA-PVRAPTYPTPLKSFHKVGLESS--------STGSSFPADSAKPVPLAVVSL 206 K+SG + P + T PTP + H + L SS ST S F +S K + Sbjct: 163 KNSGSHMGDPNQLSTPPTPKSAGHTMELHSSFNGKHSSSSTSSLFALESLKTQNRRSSNS 222 Query: 205 DSRQGQWESR*SIHARH*LDDE----AFGYLKRVIVTPAVYPRLVEFLHFDIQST 53 + Q+ + H RH + + + + TP VYP L+ + + T Sbjct: 223 SNHSSQYRRHTNQHQRHHSRSKSSPVSLTEISMIKGTPLVYPALLSLIAIKFKQT 277
>GAG_IPMA (P11365) Retrovirus-related Gag polyprotein [Contains: Protease (EC| 3.4.23.-)] Length = 827 Score = 29.6 bits (65), Expect = 4.0 Identities = 23/72 (31%), Positives = 35/72 (48%) Frame = -1 Query: 436 PDKTGPWSQKEGTCPASDPRNK*NNVKSSGISLAPVRAPTYPTPLKSFHKVGLESSSTGS 257 PD + K G+ S PR++ +K G L+ R + P K+ HKV L ++S Sbjct: 513 PDSQSAYVPKNGS---SGPRSQ--GLKDMGTGLSGPRKQSERRPRKT-HKVDLRAASDFL 566 Query: 256 SFPADSAKPVPL 221 P S +PVP+ Sbjct: 567 LMPQMSIQPVPV 578
>VRP1_YEAST (P37370) Verprolin| Length = 817 Score = 29.6 bits (65), Expect = 4.0 Identities = 21/66 (31%), Positives = 29/66 (43%) Frame = -1 Query: 394 PASDPRNK*NNVKSSGISLAPVRAPTYPTPLKSFHKVGLESSSTGSSFPADSAKPVPLAV 215 P+ P ++ + KSS ISL V AP P+ S T S P + P P Sbjct: 197 PSVRPAHRSHQRKSSNISLPSVSAPPLPS----------ASLPTHVSNPPQAPPPPPTPT 246 Query: 214 VSLDSR 197 + LDS+ Sbjct: 247 IGLDSK 252
>COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component 1 (Low| density lipoprotein receptor defect B-complementing protein) Length = 980 Score = 28.9 bits (63), Expect = 6.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 191 SLSTIQRNHSQGNGLGGISGERRPC 265 +L T+ R H G G+G + GE + C Sbjct: 293 TLETVTRQHPTGKGIGALQGEMKLC 317 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,164,766 Number of Sequences: 219361 Number of extensions: 1459005 Number of successful extensions: 3502 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3501 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)