| Clone Name | bast50a05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-assoc... | 29 | 3.8 | 2 | CS029_MOUSE (Q9CS00) Protein C19orf29 homolog | 28 | 6.6 | 3 | KIFC2_HUMAN (Q96AC6) Kinesin-like protein KIFC2 | 28 | 8.6 | 4 | CTPA_MYCLE (P46839) Cation-transporting P-type ATPase A (EC 3.6.... | 28 | 8.6 |
|---|
>BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2160 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 180 SQIPPPSTARARTSTPAFSRPSSP 109 S++PPP TA A TS P + P P Sbjct: 383 SELPPPKTAWAETSRPPETEPGPP 406
>CS029_MOUSE (Q9CS00) Protein C19orf29 homolog| Length = 772 Score = 28.5 bits (62), Expect = 6.6 Identities = 19/59 (32%), Positives = 25/59 (42%) Frame = -3 Query: 351 RSAMRMKSATR*SQRRQEAPQXXXXXXXXXXXXXXXXXAMTGRSRNRSQSVVAARWLSQ 175 RS R +S R S+RR+E + +SR RSQS+ RW SQ Sbjct: 47 RSRSRSRSHGRSSRRRREHERRRERKRRSRGRRSDSEGEQRQKSRRRSQSLRPPRWHSQ 105
>KIFC2_HUMAN (Q96AC6) Kinesin-like protein KIFC2| Length = 838 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 171 PPPSTARARTSTPAFSRPSSP 109 P P+TARAR S P + PSSP Sbjct: 800 PVPTTARARLSRPQRACPSSP 820
>CTPA_MYCLE (P46839) Cation-transporting P-type ATPase A (EC 3.6.3.-)| Length = 780 Score = 28.1 bits (61), Expect = 8.6 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -3 Query: 228 GRSRNRSQSVVAARWLSQIPPPSTARARTSTPAFSRPSSPLLHR 97 G SR+R+ RW + PPP+ R+ +P + P P+ HR Sbjct: 734 GTSRHRT----VKRW--RCPPPTRLRSTACSPVDASPLRPVAHR 771 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.304 0.129 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,707,469 Number of Sequences: 219361 Number of extensions: 161810 Number of successful extensions: 499 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 498 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.8 bits)