| Clone Name | bast50a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SWC4_ASPFU (Q4WNY4) SWR1-complex protein 4 | 30 | 1.1 | 2 | MA2B2_HUMAN (Q9Y2E5) Epididymis-specific alpha-mannosidase precu... | 28 | 7.0 | 3 | UVRC_CHLCH (Q3AQX4) UvrABC system protein C (Protein uvrC) (Exci... | 28 | 7.0 | 4 | N4BP3_MOUSE (Q8C7U1) NEDD4-binding protein 3 (N4BP3) | 28 | 7.0 | 5 | BUD23_YEAST (P25627) Putative methyltransferase BUD23 (EC 2.1.1.... | 27 | 9.2 |
|---|
>SWC4_ASPFU (Q4WNY4) SWR1-complex protein 4| Length = 588 Score = 30.4 bits (67), Expect = 1.1 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = -1 Query: 359 RLTSAAASPVDAEKATSLS*SRWCSLILSPTPRASSARKALVHVLNAYPDARSVADDSST 180 +LT A ++ + AT+L+ +L PT R + L+H +N DAR V++ + Sbjct: 430 KLTQAKSNVQSQKLATALAELEIPPRLLMPTERVCKEFEKLIHSVNLLLDARKVSEKIES 489 Query: 179 TLR 171 +R Sbjct: 490 EIR 492
>MA2B2_HUMAN (Q9Y2E5) Epididymis-specific alpha-mannosidase precursor (EC| 3.2.1.24) (Mannosidase alpha class 2B member 2) Length = 1009 Score = 27.7 bits (60), Expect = 7.0 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 223 FNTWTNAFRALDALGVGDKIREHH-LLYERLVAFSASTGEAAAEVSLK 363 + T + FRAL AL V ++R+HH L F A TG + SLK Sbjct: 322 YATLGDYFRALHALNVTWRVRDHHDFLPYSTEPFQAWTGFYTSRSSLK 369
>UVRC_CHLCH (Q3AQX4) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 629 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 256 DALGVGDKIREHHLLYERLVAFSASTGEAAAEVSLKM 366 DA GV KIRE LL + + + + GE+ A + L+M Sbjct: 279 DACGVIFKIREGKLLGSQRIYINNTNGESEASMQLRM 315
>N4BP3_MOUSE (Q8C7U1) NEDD4-binding protein 3 (N4BP3)| Length = 537 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 290 CSLILSPTPRASSARKALVHVLN 222 C LSP PRAS AR L+H L+ Sbjct: 150 CHPPLSPGPRASQARAQLLHALS 172
>BUD23_YEAST (P25627) Putative methyltransferase BUD23 (EC 2.1.1.-) (Bud site| selection protein 23) Length = 275 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -1 Query: 377 LMPCIFRLTSAAASPVDAEKATSLS*SRWCSLILSPTPRASSARKAL 237 L PC F L S + E T WC L +SP+ A+ + L Sbjct: 45 LQPCSFILDIGCGSGLSGEILTQEGDHVWCGLDISPSMLATGLSREL 91 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,323,674 Number of Sequences: 219361 Number of extensions: 592514 Number of successful extensions: 1636 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1636 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)