| Clone Name | bast48g12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SECA_ECOLI (P10408) Preprotein translocase secA subunit | 33 | 0.17 | 2 | TCF17_HUMAN (O60765) Zinc finger protein 354A (Transcription fac... | 30 | 1.4 | 3 | POL_SIVSP (P19505) Pol polyprotein [Contains: Protease (Retropep... | 28 | 7.1 | 4 | POL_SIVS4 (P12502) Pol polyprotein [Contains: Protease (Retropep... | 28 | 7.1 |
|---|
>SECA_ECOLI (P10408) Preprotein translocase secA subunit| Length = 901 Score = 33.1 bits (74), Expect = 0.17 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 4/67 (5%) Frame = -1 Query: 204 QDRVPEEVEQLQHQ----DERLRQDDAVAH*REPHGRQARAHACN*RERKHGRSESGRWD 37 Q R+PEEVE+L+ Q ERL Q ++H ++ A A A ERK GR++ Sbjct: 830 QVRMPEEVEELEQQRRMEAERLAQMQQLSH-QDDDSAAAAALAAQTGERKVGRNDPCPCG 888 Query: 36 GGRKERR 16 G+K ++ Sbjct: 889 SGKKYKQ 895
>TCF17_HUMAN (O60765) Zinc finger protein 354A (Transcription factor 17) (Zinc| finger protein eZNF) Length = 605 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -2 Query: 221 SEERQSKTACRRKSSSCSTRMSGCGRM 141 +EE K RK+SSCST +SGC R+ Sbjct: 321 AEENPCKYNPGRKASSCSTSLSGCQRI 347
>POL_SIVSP (P19505) Pol polyprotein [Contains: Protease (Retropepsin) (EC| 3.4.23.-); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT); Integrase (IN)] Length = 1022 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 Query: 179 SSCSTRMSGCGRMTQ*HTDGNPMAGRHARTL 87 ++CS R S CG + H DG G TL Sbjct: 32 TNCSPRGSSCGSTEELHEDGQKAEGEQRETL 62
>POL_SIVS4 (P12502) Pol polyprotein [Contains: Protease (Retropepsin) (EC| 3.4.23.-); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT); Integrase (IN)] Length = 1019 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 Query: 179 SSCSTRMSGCGRMTQ*HTDGNPMAGRHARTL 87 ++CS R S CG + H DG G TL Sbjct: 29 TNCSPRGSSCGSTEELHEDGQKAEGEQRETL 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,508,912 Number of Sequences: 219361 Number of extensions: 234418 Number of successful extensions: 656 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 655 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)