| Clone Name | bast48f10 |
|---|---|
| Clone Library Name | barley_pub |
>X3CL1_RAT (O55145) Fractalkine precursor (CX3CL1) (Neurotactin) (CX3C| membrane-anchored chemokine) (Small inducible cytokine D1) Length = 393 Score = 29.6 bits (65), Expect = 1.9 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = +3 Query: 3 NHTHTHIFTDQSSRSPRHPSARTRSSERQWQEPAPPRVTS 122 N HT IF D+ S HPS SSE+ P+P V S Sbjct: 264 NPVHTDIFQDRGPGSTVHPSVAPTSSEK---TPSPELVAS 300
>SGOL2_HUMAN (Q562F6) Shugoshin-like 2 (Tripin)| Length = 1265 Score = 28.1 bits (61), Expect = 5.5 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 7/45 (15%) Frame = +3 Query: 15 THIFTDQSSRSPRHPSARTRSS-ERQWQEPAPPRVT------SSW 128 +H +DQSS++ R S R+W++P+P VT SSW Sbjct: 236 SHSHSDQSSKTSLMSEMRNAQSIGRRWEKPSPSNVTERKKRGSSW 280
>DYHC_PARTE (Q27171) Dynein heavy chain, cytosolic (DYHC) (DHC08)| Length = 4540 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/42 (30%), Positives = 16/42 (38%) Frame = +3 Query: 3 NHTHTHIFTDQSSRSPRHPSARTRSSERQWQEPAPPRVTSSW 128 NH H FT + + P RT QW E P + W Sbjct: 4180 NHNHPLFFTLEGKEAITVPEGRTYLDFMQWIEQLPKTESPEW 4221
>SSB_PSEAE (P40947) Single-stranded DNA-binding protein (SSB)| (Helix-destabilizing protein) Length = 164 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 DQSSRSPRHPSARTRSSERQWQEPAP 107 D S R+PR P R + + +Q PAP Sbjct: 118 DDSQRAPREPMQRPQQAPQQQSRPAP 143
>TGM1_CANFA (Q9GLK0) Protein-glutamine gamma-glutamyltransferase K (EC| 2.3.2.13) (Transglutaminase K) (TGase K) (TGK) (TG(K)) (Transglutaminase-1) (Epidermal TGase) Length = 815 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 182 PSTISAAPEPSPYPLLQPRHGGR 250 P+T S PEP P P + R GGR Sbjct: 19 PTTPSPEPEPEPEPERRSRRGGR 41
>FOXE3_HUMAN (Q13461) Forkhead box protein E3 (Forkhead-related protein FKHL12)| (Forkhead-related transcription factor 8) (FREAC-8) Length = 319 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 307 AAAPVPGPGRRRAGTVRRG 363 A P PGPGRRR ++RG Sbjct: 52 APTPAPGPGRRRRRPLQRG 70
>VCOM_ADEM1 (O10442) Minor core protein (Protein V) (pV)| Length = 228 Score = 27.3 bits (59), Expect = 9.3 Identities = 20/77 (25%), Positives = 28/77 (36%) Frame = +2 Query: 8 HAHTHLHRPILSLAAPPQRTHTQLRAPMARTGAAPRHXXXXXXXXXXXXXXXXXXXXQPS 187 H + RP + +PP+R + R+P R AA R P Sbjct: 140 HPSIEVARPPAARISPPRRRRRRRRSPRPRATAAYRSSAEVVERRRRVAQTVPVVRYHP- 198 Query: 188 TISAAPEPSPYPLLQPR 238 S EP+ +P L PR Sbjct: 199 --SIQVEPAVHPPLAPR 213 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.130 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,239,157 Number of Sequences: 219361 Number of extensions: 403732 Number of successful extensions: 1517 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1511 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)