| Clone Name | bast48f06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TR19L_HUMAN (Q969Z4) Tumor necrosis factor receptor superfamily ... | 32 | 1.1 | 2 | TR19L_MACFA (Q9N092) Tumor necrosis factor receptor superfamily ... | 30 | 2.3 | 3 | RHAD_ECOLI (P32169) Rhamnulose-1-phosphate aldolase (EC 4.1.2.19) | 29 | 5.2 | 4 | RHAD_ECOL6 (Q8FBE1) Rhamnulose-1-phosphate aldolase (EC 4.1.2.19) | 29 | 5.2 |
|---|
>TR19L_HUMAN (Q969Z4) Tumor necrosis factor receptor superfamily member 19L| precursor (Receptor expressed in lymphoid tissues) Length = 430 Score = 31.6 bits (70), Expect = 1.1 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -1 Query: 339 CRPCSSGRKSREWSRSASLPPERCSSLTR--ASVSVEARD 226 CRPC G S W S P RCS R A V + RD Sbjct: 48 CRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRD 87
>TR19L_MACFA (Q9N092) Tumor necrosis factor receptor superfamily member 19L| precursor (Receptor expressed in lymphoid tissues) Length = 430 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 339 CRPCSSGRKSREWSRSASLPPERCSSLTRASVSV 238 CRPC G S W S P RCS R V Sbjct: 48 CRPCPPGTFSAAWGSSPCQPHARCSLQRRLEAQV 81
>RHAD_ECOLI (P32169) Rhamnulose-1-phosphate aldolase (EC 4.1.2.19)| Length = 274 Score = 29.3 bits (64), Expect = 5.2 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 224 QSLASTDTDALVKE-EQRSGGKLALRLHSRDFLPEEQGRHE 343 Q + TDA +K ++R+GG L LRL D P H+ Sbjct: 11 QGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQ 51
>RHAD_ECOL6 (Q8FBE1) Rhamnulose-1-phosphate aldolase (EC 4.1.2.19)| Length = 274 Score = 29.3 bits (64), Expect = 5.2 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 224 QSLASTDTDALVKE-EQRSGGKLALRLHSRDFLPEEQGRHE 343 Q + TDA +K ++R+GG L LRL D P H+ Sbjct: 11 QGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQ 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,700,911 Number of Sequences: 219361 Number of extensions: 233508 Number of successful extensions: 858 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 858 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)