| Clone Name | bast48f03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GEMI5_HUMAN (Q8TEQ6) Gem-associated protein 5 (Gemin5) | 32 | 0.59 | 2 | GLR_MOUSE (Q61606) Glucagon receptor precursor (GL-R) | 29 | 6.6 | 3 | MMP19_MOUSE (Q9JHI0) Matrix metalloproteinase-19 precursor (EC 3... | 28 | 8.6 |
|---|
>GEMI5_HUMAN (Q8TEQ6) Gem-associated protein 5 (Gemin5)| Length = 1508 Score = 32.3 bits (72), Expect = 0.59 Identities = 21/42 (50%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +3 Query: 291 ARTSDAVSVA-FGDAYRNEAYGARLPPGAFERCGTDTFRVSG 413 AR SDAV FG A R + R+ PGA E GT FRV G Sbjct: 17 ARCSDAVPGGLFGFAARTSVFLVRVGPGAGESPGTPPFRVIG 58
>GLR_MOUSE (Q61606) Glucagon receptor precursor (GL-R)| Length = 485 Score = 28.9 bits (63), Expect = 6.6 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -3 Query: 143 TRHCRRRGEDVGMGMWEGGGARAGC 69 TR+ ++ G+D+ + +W GA AGC Sbjct: 201 TRYSQKIGDDLSVSVWLSDGAMAGC 225
>MMP19_MOUSE (Q9JHI0) Matrix metalloproteinase-19 precursor (EC 3.4.24.-)| (MMP-19) (Matrix metalloproteinase RASI) Length = 527 Score = 28.5 bits (62), Expect = 8.6 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -1 Query: 403 RKVSVPHRSKAPGGRRAPYASFRYASPNATLTASDVRAGDAQLVFTF 263 R +VP P R A + +F+Y S A LT +V+AG A + +F Sbjct: 113 RIFNVPSTLSLPRVRAALHQAFKYWSSVAPLTFREVKAGWADIRLSF 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,398,478 Number of Sequences: 219361 Number of extensions: 581317 Number of successful extensions: 1961 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1960 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)