| Clone Name | bast48b06 |
|---|---|
| Clone Library Name | barley_pub |
>CREB5_HUMAN (Q02930) cAMP response element-binding protein 5 (CRE-BPa)| Length = 508 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 3/29 (10%) Frame = +2 Query: 14 HQRHDSPPQSPFPHPRTHP---QNPKPHH 91 HQ PP P+PH HP +P+PHH Sbjct: 279 HQHQTLPPHHPYPHQHQHPAHHPHPQPHH 307
>CREB5_MOUSE (Q8K1L0) cAMP response element-binding protein 5 (CRE-BPa)| (Fragment) Length = 353 Score = 34.7 bits (78), Expect = 0.057 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 3/29 (10%) Frame = +2 Query: 14 HQRHDSPPQSPFPHPRTHP---QNPKPHH 91 HQ PP P+PH HP +P+PHH Sbjct: 124 HQHQTLPPHHPYPHQHQHPAHHPHPQPHH 152
>SEPP1_BOVIN (P49907) Selenoprotein P-like protein precursor| Length = 402 Score = 33.9 bits (76), Expect = 0.097 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +2 Query: 23 HDSPPQSPFPHPRTHPQ-NPKPHHG 94 H P P PHP HP +P PHHG Sbjct: 206 HPHPHSHPHPHPHPHPHPHPHPHHG 230
>AFLR_ASPPA (P43651) Aflatoxin biosynthesis regulatory protein| Length = 444 Score = 33.1 bits (74), Expect = 0.17 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 2 PTGNHQRHDSPPQSPFPHPRTHPQNPKPHHGGAVPD 109 P + Q H P PHP++HPQ+ +P H P+ Sbjct: 102 PHAHTQAHTHAHSHPQPHPQSHPQSNQPPHALPTPN 137
>AFLR_ASPFL (P41765) Aflatoxin biosynthesis regulatory protein| Length = 437 Score = 33.1 bits (74), Expect = 0.17 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 2 PTGNHQRHDSPPQSPFPHPRTHPQNPKPHHGGAVPD 109 P + Q H P PHP++HPQ+ +P H P+ Sbjct: 102 PHAHTQAHTHAHSHPQPHPQSHPQSNQPPHALPTPN 137
>DLL_DROME (P20009) Homeotic protein distal-less (Protein brista)| Length = 327 Score = 33.1 bits (74), Expect = 0.17 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Frame = +2 Query: 35 PQSPFP----HPRTHPQNPKPHHGGAVP 106 PQ P P HP+TH NP P GG VP Sbjct: 281 PQPPHPAATLHPQTHHHNPPPQMGGYVP 308
>FOXL2_HUMAN (P58012) Forkhead box protein L2| Length = 376 Score = 32.3 bits (72), Expect = 0.28 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 7/32 (21%) Frame = +2 Query: 32 PPQSPFPHPRTH-------PQNPKPHHGGAVP 106 PP P PHP H P PHHG A P Sbjct: 286 PPPHPHPHPHAHHLHAAAAPPPAPPHHGAAAP 317
>PO3F3_HUMAN (P20264) POU domain, class 3, transcription factor 3| (Brain-specific homeobox/POU domain protein 1) (Brain-1) (Brn-1 protein) Length = 500 Score = 31.6 bits (70), Expect = 0.48 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 Query: 11 NHQRHDSPPQSPFPHPRTHPQNPKPHHGG 97 +H H + P P PH H Q P PHHGG Sbjct: 272 HHHHHHAHPHPPHPH---HAQGP-PHHGG 296
>BCD_DROME (P09081) Homeotic protein bicoid (PRD-4)| Length = 494 Score = 30.8 bits (68), Expect = 0.82 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +2 Query: 2 PTGNHQRHDSPPQSPFPHPRTHP---QNPKPHH 91 P N H P PHP +HP +P PHH Sbjct: 6 PDQNFYHHPLPHTHTHPHPHSHPHPHSHPHPHH 38
>OSA_DROME (Q8IN94) Trithorax group protein osa (Protein eyelid)| Length = 2716 Score = 30.0 bits (66), Expect = 1.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 32 PPQSPFPHPRTHPQNPKPH 88 PP PHP HPQ+ PH Sbjct: 1727 PPSHQHPHPHQHPQHQHPH 1745
>FOXJ3_MOUSE (Q8BUR3) Forkhead box protein J3| Length = 623 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 20 RHDSPPQSPFPHPRTHPQNPKPH 88 +H PQ P PHP+ H Q PH Sbjct: 393 QHPQRPQHPAPHPQQHSQLQPPH 415
>RBL1_MOUSE (Q64701) Retinoblastoma-like protein 1 (107 kDa| retinoblastoma-associated protein) (PRB1) (P107) Length = 1063 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 11/36 (30%) Frame = +2 Query: 26 DSPPQSPFPHPRTHPQNPK-----------PHHGGA 100 D+PP SPFPH + P +P+ PH GA Sbjct: 954 DAPPLSPFPHIKQQPGSPRRISQQHSLYVSPHKNGA 989
>UHPT_CHLPN (Q9Z7N9) Probable hexose phosphate transport protein| Length = 455 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 90 WWGLGFWGWVRGWGNGLCGGLS*RW 16 WWGL GW +GWG C L W Sbjct: 127 WWGLN--GWFQGWGWPPCARLLTHW 149
>NOTC4_HUMAN (Q99466) Neurogenic locus notch homolog protein 4 precursor (Notch 4)| (hNotch4) [Contains: Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 2003 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 Query: 2 PTGNHQRHDSPPQSPFPHPRTHPQNPKPHHGGAVP 106 P H+ PFP RT + PH GGA+P Sbjct: 1825 PEARHKATPGREAGPFPRARTVSVSVPPHGGGALP 1859
>NBL1_HUMAN (P41271) Neuroblastoma suppressor of tumorigenicity 1 precursor| (Zinc finger protein DAN) (N03) Length = 180 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 17 QRHDSPPQSPFPHPRTHPQNPKPHHGGAVPD 109 Q D P P HP HP PH GG P+ Sbjct: 136 QGEDGPGSQPGTHPHPHPH---PHPGGQTPE 163
>FOXL2_MOUSE (O88470) Forkhead box protein L2 (Pituitary forkhead factor)| (P-Frk) Length = 375 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 11/36 (30%) Frame = +2 Query: 32 PPQSPFPHPRTHPQ-----------NPKPHHGGAVP 106 PP P PHP HP PHHG A P Sbjct: 281 PPPPPPPHPHPHPHAHHLHAAAAPPPAPPHHGAAAP 316
>ZIC5_HUMAN (Q96T25) Zinc finger protein ZIC 5 (Zinc finger protein of the| cerebellum 5) Length = 639 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +2 Query: 8 GNHQRHDSPPQSPFPHPRT--HPQNPKPHHGGA 100 G H +H +PP +P P P HP PH GA Sbjct: 324 GPHLQHHAPPPAPPPPPAPAQHPHQHHPHLPGA 356
>YH17_YEAST (P38898) Hypothetical 17.1 kDa protein in PUR5 3'region| Length = 153 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Frame = +2 Query: 5 TGNHQRHDSPPQSPFPHPRT-HPQ---NPKPHH 91 T H +P +P PHP T HP P PHH Sbjct: 32 TPTHTHPHTPTPTPHPHPHTPHPHTTPTPTPHH 64 Score = 28.1 bits (61), Expect = 5.3 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 Query: 14 HQRHDSPPQSPFPHPRTHPQNPKPH 88 H + P +P P P HP P PH Sbjct: 31 HTPTHTHPHTPTPTPHPHPHTPHPH 55
>HD_MOUSE (P42859) Huntingtin (Huntington disease protein homolog) (HD| protein) Length = 3119 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 17 QRHDSPPQSPFPHPRTHPQNPKPHHGGAVP 106 Q+ PPQ+P P P PQ P+P G P Sbjct: 21 QQQQPPPQAPPPPPPPPPQPPQPPPQGQPP 50
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +2 Query: 23 HDSPPQSPFPHPRTHP-QNPKPH 88 H P P PHP HP Q P PH Sbjct: 217 HSHPHSHPHPHPHPHPHQIPHPH 239
>ACRO_RABIT (P48038) Acrosin precursor (EC 3.4.21.10) [Contains: Acrosin light| chain; Acrosin heavy chain] Length = 431 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 2 PTGNHQRHDSPPQS-PFPHPRTHPQNPKPHHGGAVP 106 P Q PP P PHP HP+ P+P A P Sbjct: 318 PPWYFQHASGPPHPHPHPHPHPHPRPPQPPAAQAPP 353
>RBL1_HUMAN (P28749) Retinoblastoma-like protein 1 (107 kDa| retinoblastoma-associated protein) (PRB1) (P107) Length = 1068 Score = 29.3 bits (64), Expect = 2.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 26 DSPPQSPFPHPRTHPQNPK 82 D+PP SPFPH + P +P+ Sbjct: 959 DAPPLSPFPHIKQQPGSPR 977
>SHAN1_RAT (Q9WV48) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (GKAP/SAPAP-interacting protein) (SPANK-1) (Synamon) (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2167 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 Query: 11 NHQRHDSPPQSPFPHPRTHPQNPKPHHGGAVPD 109 +H H +PP P H HP +P G PD Sbjct: 1010 HHHHHHAPPPQPH-HHHAHPPHPPEMETGGSPD 1041
>SOX1_MOUSE (P53783) SOX-1 protein| Length = 391 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/20 (55%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +2 Query: 35 PQSPFPH-PRTHPQNPKPHH 91 P P PH P HP NP+P H Sbjct: 228 PAHPHPHHPHAHPHNPQPMH 247 Score = 28.9 bits (63), Expect = 3.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 53 HPRTHPQNPKPHHGGAVP 106 HP HP +P PHH A P Sbjct: 223 HPHAHPAHPHPHHPHAHP 240
>SHAN1_HUMAN (Q9Y566) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2161 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 Query: 11 NHQRHDSPPQSPFPHPRTHPQNPKPHHGGAVPD 109 +H H +PP P H HP +P G PD Sbjct: 1002 HHHHHHAPPPQPH-HHHAHPPHPPEMETGGSPD 1033
>SOX1_HUMAN (O00570) SOX-1 protein| Length = 387 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/20 (55%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +2 Query: 35 PQSPFPH-PRTHPQNPKPHH 91 P P PH P HP NP+P H Sbjct: 228 PAHPHPHHPHAHPHNPQPMH 247
>PRP3_RAT (P04474) Acidic proline-rich protein PRP33 precursor (Proline-rich| proteoglycan 1) Length = 206 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 7/37 (18%) Frame = +2 Query: 8 GNHQR-----HDSPPQSPFPHPRTHPQNPK--PHHGG 97 GNHQR H PP S P + P NP+ P GG Sbjct: 85 GNHQRPPPGHHHGPPPSGGPQTSSQPGNPQGPPPQGG 121
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +2 Query: 5 TGNHQRHDSPPQSPFPHPRTHPQNP---KPHHGGAVP 106 T H H PP +P HP+ PQ P HHG P Sbjct: 68 TPKHPPHVKPPSTP-KHPKHPPQKPCPPPSHHGPKPP 103
>YNM4_YEAST (P53919) Hypothetical 54.9 kDa protein in SPC98-TOM70 intergenic| region Length = 492 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 32 PPQSPFPHPRTHPQNPKPHHGGAVP 106 PP SPFP P T+ Q P P G A P Sbjct: 372 PPYSPFPQP-TNFQYPPPPFGQATP 395
>PO3F3_MOUSE (P31361) POU domain, class 3, transcription factor 3| (Brain-specific homeobox/POU domain protein 1) (Brain-1) (Brn-1 protein) Length = 495 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 11 NHQRHDSPPQSPFPHPRTHPQNPKPHHGG 97 +H H + P P PH H Q P HHGG Sbjct: 269 HHHHHHAHPHPPHPH---HAQGPP-HHGG 293
>PO3F3_RAT (Q63262) POU domain, class 3, transcription factor 3| (Brain-specific homeobox/POU domain protein 1) (Brain-1) (Brn-1 protein) Length = 497 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 11 NHQRHDSPPQSPFPHPRTHPQNPKPHHGG 97 +H H + P P PH H Q P HHGG Sbjct: 271 HHHHHHAHPHPPHPH---HAQGPP-HHGG 295
>YAAX_ECOLI (P75616) Hypothetical protein yaaX precursor| Length = 98 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 8 GNHQRHDSPPQSPFPHPRTHPQNPKPHHGGAVP 106 GN PP P PR H + P HHGG P Sbjct: 65 GNRWHLHGPP----PPPRHHKKAPHDHHGGHGP 93
>GRISA_PODAN (Q92258) GRISEA protein (MAC1 homolog)| Length = 597 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +2 Query: 2 PTGNHQRHDSPPQSPFPHPRTH---PQNPKPHHGGAVP 106 P G + PP P PH H PQ+ K +GG VP Sbjct: 182 PMGYNMPPSMPPHMPPPHYPPHIQIPQHIKTENGGFVP 219
>NBL1_MOUSE (Q61477) Neuroblastoma suppressor of tumorigenicity 1 precursor| (Zinc finger protein DAN) (N03) Length = 178 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 17 QRHDSPPQSPFPHPRTHPQNPKPHHGGAVPD 109 Q DSP P PH H PH GG P+ Sbjct: 136 QGEDSPGSQPGPHSHAH-----PHPGGQTPE 161
>PRIO_CHICK (P27177) Major prion protein homolog precursor (PR-LP)| (Acetylcholine receptor-inducing activity) (ARIA) (65-21 protein) Length = 273 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 8 GNHQRHDSPPQSPFPHPRTHPQNP-KPHHGG 97 G+H++ P Q +PH +P NP PH+ G Sbjct: 39 GSHRQPSYPRQPGYPHNPGYPHNPGYPHNPG 69
>K10_DROME (P13468) DNA-binding protein K10 (Female sterile protein K10)| Length = 463 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +2 Query: 2 PTGNHQRHDSP--PQSPFPHPRTHPQNPKPHH 91 P+ N Q+H SP Q P P+ + HP + + H Sbjct: 139 PSPNQQQHPSPNQQQHPSPNQQQHPNSNQQQH 170
>SGP1_THIRO (P56623) Sulfur globule protein TR0 (Fragment)| Length = 40 Score = 27.7 bits (60), Expect = 6.9 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 90 WWGLGFWGWVRGWGNGL 40 WWG G+ G+ G+G+GL Sbjct: 1 WWGPGYGGYGPGYGSGL 17
>PYGO_DROME (Q9V9W8) Protein pygopus (Protein gammy legs)| Length = 815 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 6/31 (19%) Frame = +2 Query: 32 PPQSPF----PHPR--THPQNPKPHHGGAVP 106 PPQ P PHP HP +P H GG P Sbjct: 568 PPQQPSHLGPPHPNMMNHPHHPHHHPGGPPP 598 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 10/35 (28%) Frame = +2 Query: 32 PPQSPFPHPRTHPQNP----------KPHHGGAVP 106 PP P HP HP +P PH GG P Sbjct: 152 PPPPPHMHPHMHPHHPGGPMGHPHGPHPHMGGPPP 186
>PROP1_THEGE (Q3LU41) Homeobox protein prophet of Pit-1 (PROP-1)| (Pituitary-specific homeodomain factor) Length = 226 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 32 PPQSPFPHPRTHPQNPKPHHGGA 100 PP + FPHP +H +P GGA Sbjct: 162 PPVTCFPHPYSHALPSQPSTGGA 184
>PROP1_HUMAN (O75360) Homeobox protein prophet of Pit-1 (PROP-1)| (Pituitary-specific homeodomain factor) Length = 226 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 32 PPQSPFPHPRTHPQNPKPHHGGA 100 PP + FPHP +H +P GGA Sbjct: 162 PPVTCFPHPYSHALPSQPSTGGA 184
>JHD2C_MOUSE (Q69ZK6) Probable JmjC domain-containing histone demethylation| protein 2C (EC 1.14.11.-) (Jumonji domain-containing protein 1C) Length = 2350 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 8 GNHQRHDSPPQSPFPHPRTHPQNPKPHH 91 G H S Q+P P THP PHH Sbjct: 580 GPHLLAGSTSQTPLPTINTHPLTSGPHH 607
>HRPX_PLALO (P04929) Histidine-rich glycoprotein precursor| Length = 351 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 2 PTGNHQRHDSPPQSPFPHPRTHPQNPKPHH 91 P +H+ H PHP H + PHH Sbjct: 82 PEEHHEPHHEEHHHHHPHPHHHHHHHPPHH 111
>ARNT_DROME (O15945) Aryl hydrocarbon receptor nuclear translocator homolog| (dARNT) (Protein tango) (Hypoxia-inducible factor 1 beta) Length = 644 Score = 27.7 bits (60), Expect = 6.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 50 PHPRTHPQNPKPHHGG 97 PHP HP +P H GG Sbjct: 590 PHPTAHPHHPHAHPGG 605
>RSP1_SCHPO (O13601) DnaJ-related protein rsp1| Length = 494 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = +2 Query: 14 HQRHDSP--PQSPFPHPRTHPQNPKP 85 H ++SP P+ PF HP + P PKP Sbjct: 295 HSDNNSPSKPEIPFRHPTSKPLPPKP 320
>PROP1_GORGO (Q3LU39) Homeobox protein prophet of Pit-1 (PROP-1)| (Pituitary-specific homeodomain factor) Length = 225 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 32 PPQSPFPHPRTHPQNPKPHHGGA 100 PP + FPHP +H +P GGA Sbjct: 161 PPVTCFPHPYSHALPSQPSTGGA 183
>TEST_MOUSE (Q9JHJ7) Testisin precursor (EC 3.4.21.-) (Tryptase 4)| Length = 324 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 5/27 (18%) Frame = -1 Query: 81 LGFWGW---VRGWGNGLCGG--LS*RW 16 LG W W +R WGN LCG L+ RW Sbjct: 63 LGRWPWQGSLRVWGNHLCGATLLNRRW 89
>FOXGA_HUMAN (P55316) Forkhead box protein G1A (Forkhead-related protein FKHL2)| (Transcription factor BF-2) (Brain factor 2) (BF2) (HFK2) Length = 469 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 Query: 11 NHQRHDSPPQSPFPHPRTHPQNPKP 85 +H H PP +P P P Q P P Sbjct: 52 HHHHHHPPPPAPQPPPPPQQQQPPP 76
>AMEL_MONDO (Q28462) Amelogenin| Length = 202 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/27 (44%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +2 Query: 29 SPPQSP-FPHPRTHPQNPKPHHGGAVP 106 +PPQ P P P HP P HH +P Sbjct: 79 APPQQPVMPVPGQHPMAPTQHHQPNLP 105
>FA44A_HUMAN (Q8NFC6) Protein FAM44A| Length = 502 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 11 NHQRHDSPPQSPFPHPRTHPQNPKPHHG-GAVP 106 N Q PP P P P+ PQ P P G GA P Sbjct: 4 NPQPQPPPPAPPPPPPQPQPQPPPPPPGPGAGP 36
>ROA1_XENLA (P17130) Heterogeneous nuclear ribonucleoproteins A1 homolog (hnRNP| A1) (Helix-destabilizing protein) (Single-strand binding protein) (hnRNP core protein A1) Length = 365 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 90 WWGLGFWGWVRGWGNGLCGG 31 WW GW RG+G G GG Sbjct: 247 WWQPSLLGWNRGYGAGQGGG 266
>PHLA1_MOUSE (Q62392) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Proline- and glutamine-rich protein) (PQR protein) Length = 261 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +2 Query: 17 QRHDSPPQSPFPHPRTHP-QNPKPH 88 Q H P P PHP +HP Q+P PH Sbjct: 201 QLHSYP--HPHPHPYSHPHQHPHPH 223 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.121 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,273,179 Number of Sequences: 219361 Number of extensions: 246825 Number of successful extensions: 1925 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 1497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1863 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)