| Clone Name | bast47g01 |
|---|---|
| Clone Library Name | barley_pub |
>ORAI1_MOUSE (Q8BWG9) Protein orai-1| Length = 304 Score = 28.9 bits (63), Expect = 3.0 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -1 Query: 269 SRTDCRKSGRRRDGDGELARSPALAPAGGVLSSMDMVPRS 150 S T + RRR GDGE + +P L P +S D + +S Sbjct: 22 SSTSGSRRSRRRSGDGEPSGAPPLPPPPPAVSYPDWIGQS 61
>BIOD_BACNA (Q8KZM8) Dethiobiotin synthetase (EC 6.3.3.3) (Dethiobiotin| synthase) (DTB synthetase) (DTBS) Length = 231 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 277 VKLGYHYLITHGMYLLLTPLIVLIAVHLSTLS 372 V LG YL++H + L P+I++ HL T++ Sbjct: 119 VPLGEDYLVSHVIKALQLPMIIVARPHLGTIN 150
>HMP_BORPE (Q7TTP0) Flavohemoprotein (Hemoglobin-like protein)| (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17) (NO oxygenase) (NOD) Length = 402 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -3 Query: 408 AEVRPQVCDVARRERGEVD---GDEHDEWGQQEVHAVGDEVVVP 286 A RP V ER D G ++D G+ ++HA+ DEV++P Sbjct: 318 AAKRPNVRKAVFYERVGADDRRGVDYDYEGRVDLHAIRDEVILP 361
>HMP_BORPA (Q7TTP2) Flavohemoprotein (Hemoglobin-like protein)| (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17) (NO oxygenase) (NOD) Length = 402 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -3 Query: 408 AEVRPQVCDVARRERGEVD---GDEHDEWGQQEVHAVGDEVVVP 286 A RP V ER D G ++D G+ ++HA+ DEV++P Sbjct: 318 AAKRPNVRKAVFYERVGADDRRGVDYDYEGRVDLHAIRDEVILP 361
>HMP_BORBR (Q7WHW5) Flavohemoprotein (Hemoglobin-like protein)| (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17) (NO oxygenase) (NOD) Length = 402 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -3 Query: 408 AEVRPQVCDVARRERGEVD---GDEHDEWGQQEVHAVGDEVVVP 286 A RP V ER D G ++D G+ ++HA+ DEV++P Sbjct: 318 AAKRPNVRKAVFYERVGADDRRGVDYDYEGRVDLHAIRDEVILP 361
>LRP5_MOUSE (Q91VN0) Low-density lipoprotein receptor-related protein 5 precursor| (LRP7) (Lr3) Length = 1614 Score = 27.7 bits (60), Expect = 6.8 Identities = 25/95 (26%), Positives = 32/95 (33%), Gaps = 17/95 (17%) Frame = -1 Query: 344 STMSGVSRRYMPWVMR*WYPSLTYLSRTDCRKSGRRRDGDGELAR--------------- 210 S + +R Y P+V+R P T S C D D ++R Sbjct: 1518 SGIPATARPYRPYVIRGMAPPTTPCSTDVC-------DSDYSISRWKSSKYYLDLNSDSD 1570 Query: 209 --SPALAPAGGVLSSMDMVPRSNGRSDDQCHRTPP 111 P P LS+ D P S G CH PP Sbjct: 1571 PYPPPPTPHSQYLSAEDSCPPSPGTERSYCHLFPP 1605
>PSIE_BACC1 (Q72Y02) Protein psiE homolog| Length = 133 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 268 LKYVKLGYHYLITHGMYLLLTPLIVLIAV 354 +KY K YH+ + + +Y+ +T LI LI V Sbjct: 72 IKYFKSNYHFPLRYFIYIGITALIRLIIV 100
>PSIE_BACHK (Q6HBH8) Protein psiE homolog| Length = 134 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 268 LKYVKLGYHYLITHGMYLLLTPLIVLIAV 354 +KY K YH+ + + +Y+ +T LI LI V Sbjct: 73 IKYFKSNYHFPLRYFIYIGITALIRLIIV 101
>PSIE_BACAN (Q81XB6) Protein psiE homolog| Length = 134 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 268 LKYVKLGYHYLITHGMYLLLTPLIVLIAV 354 +KY K YH+ + + +Y+ +T LI LI V Sbjct: 73 IKYFKSNYHFPLRYFIYIGITALIRLIIV 101
>TYRT_STRAT (P17687) Tyrosinase cofactor (ORF438)| Length = 146 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -1 Query: 221 ELARSPALAPAGGVLSSMDMVPRSNGRSDDQCHRTP 114 EL R AL A V + + +V R+DD+ H TP Sbjct: 3 ELTRRRALGAAAVVAAGVPLVALPAARADDRGHHTP 38
>RLUB_PSEAE (Q9HZ55) Ribosomal large subunit pseudouridine synthase B (EC| 5.4.99.-) (rRNA-uridine isomerase B) (rRNA pseudouridylate synthase B) Length = 386 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -1 Query: 254 RKSGRRRDGDGELARSPALAPAGGVLSSMDMVPRSNG 144 +++ RR DG+ R+PA PA G S + R G Sbjct: 294 KRAPRREDGENAARRAPASRPARGPQPSAERKGREQG 330 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,180,456 Number of Sequences: 219361 Number of extensions: 623449 Number of successful extensions: 1899 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1899 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)