| Clone Name | bast47f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FLA1_ARATH (Q9FM65) Fasciclin-like arabinogalactan protein 1 pre... | 59 | 3e-12 | 2 | FLA7_ARATH (Q9SJ81) Fasciclin-like arabinogalactan protein 7 pre... | 40 | 0.002 | 3 | FLA10_ARATH (Q9LZX4) Fasciclin-like arabinogalactan protein 10 p... | 31 | 0.005 | 4 | FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 pre... | 28 | 0.017 |
|---|
>FLA1_ARATH (Q9FM65) Fasciclin-like arabinogalactan protein 1 precursor| Length = 424 Score = 59.3 bits (142), Expect(2) = 3e-12 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +1 Query: 298 DGGVTAFCPSDDAARSFMPRYKNLTADGKASLLLFHAVPVYYA 426 +GG+T FCP DDA + F+P+YKNLTA K + L F AVP YY+ Sbjct: 218 EGGMTVFCPGDDAMKGFLPKYKNLTAPKKEAFLDFLAVPTYYS 260 Score = 30.4 bits (67), Expect(2) = 3e-12 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 201 NITAAMAKGGCKAFAALVAASPDAHSTFQSA 293 N+T M+ GCK FA + +P A T+Q + Sbjct: 186 NLTGIMSAHGCKVFAETLLTNPGASKTYQES 216
>FLA7_ARATH (Q9SJ81) Fasciclin-like arabinogalactan protein 7 precursor| Length = 254 Score = 40.0 bits (92), Expect = 0.002 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +1 Query: 304 GVTAFCPSDDAARSFM-PRYKNLTADGKASLLLFHAVPVYYA 426 G+T F P DDA ++ P NLT D L+LFHA+P YY+ Sbjct: 83 GITIFVPKDDAFKAQKNPPLSNLTKDQLKQLVLFHALPHYYS 124
>FLA10_ARATH (Q9LZX4) Fasciclin-like arabinogalactan protein 10 precursor| Length = 422 Score = 30.8 bits (68), Expect(2) = 0.005 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 304 GVTAFCPSDDAARS-FMPRYKNLTADGKASLLLFHAVPVY 420 G+T F PSD+A ++ +P NLT SLL +HA+ Y Sbjct: 223 GLTVFAPSDEAFKARGVPDLTNLTQAEVVSLLEYHALAEY 262 Score = 27.3 bits (59), Expect(2) = 0.005 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 201 NITAAMAKGGCKAFAALVAASPDAHSTFQS 290 NIT + K GCK FA L+ +S TF+S Sbjct: 190 NITGLLEKAGCKTFANLLVSS-GVIKTFES 218
>FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 precursor| (AtAGP8) Length = 420 Score = 28.5 bits (62), Expect(2) = 0.017 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 304 GVTAFCPSDDAARS-FMPRYKNLTADGKASLLLFHAVPVY 420 G+T F PSD+A ++ +P LT SLL +HA+ Y Sbjct: 222 GLTVFAPSDEAFKAEGVPDLTKLTQAEVVSLLEYHALAEY 261 Score = 27.7 bits (60), Expect(2) = 0.017 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +3 Query: 201 NITAAMAKGGCKAFAALVAASPDAHSTFQSA 293 NIT + K GCK FA L+ +S T++SA Sbjct: 189 NITGLLEKAGCKTFANLLVSS-GVLKTYESA 218 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,222,863 Number of Sequences: 219361 Number of extensions: 504216 Number of successful extensions: 1918 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1913 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)