| Clone Name | bast47b10 |
|---|---|
| Clone Library Name | barley_pub |
>UBP21_MOUSE (Q9QZL6) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 566 Score = 33.5 bits (75), Expect = 0.15 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = +3 Query: 6 KVINPTMFDQVLRNFTPDVPAGTSARPRQEHAQEFLSYAMDRMHDELLR 152 + +NPT F V + + P +G S Q+ AQEFL M+R+H E+ R Sbjct: 276 EAVNPTRFRAVFQKYVPSF-SGYS----QQDAQEFLKLLMERLHLEINR 319
>UBP21_HUMAN (Q9UK80) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific-processing protease 21) (Deubiquitinating enzyme 21) (NEDD8-specific protease) Length = 565 Score = 33.5 bits (75), Expect = 0.15 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = +3 Query: 6 KVINPTMFDQVLRNFTPDVPAGTSARPRQEHAQEFLSYAMDRMHDELLR 152 + +NPT F V + + P +G S Q+ AQEFL M+R+H E+ R Sbjct: 276 EAVNPTRFRAVFQKYVPSF-SGYS----QQDAQEFLKLLMERLHLEINR 319
>UBP7_YEAST (P40453) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) Length = 1071 Score = 32.3 bits (72), Expect = 0.34 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +3 Query: 18 PTMFDQVLRNFTPDVPAGTSARPRQEHAQEFLSYAMDRMHDEL 146 PT F +V+ PD+ Q+ QEFL +DR+HDEL Sbjct: 681 PTGFLKVINQLRPDLKIPDD----QQDTQEFLMILLDRLHDEL 719
>UBP3_YEAST (Q01477) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 912 Score = 32.0 bits (71), Expect = 0.45 Identities = 15/41 (36%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = +3 Query: 90 QEHAQEFLSYAMDRMHDELL-RLNGNGLNSKEGMVVSSDDD 209 QE A+EFL++ +D++H+EL+ ++G N + M+ S +D+ Sbjct: 583 QEDAEEFLTHLLDQLHEELISAIDGLTDNEIQNMLQSINDE 623
>UBP10_HUMAN (Q14694) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 798 Score = 31.2 bits (69), Expect = 0.76 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +3 Query: 75 SARPRQEHAQEFLSYAMDRMHDELLRLNGNGLNSKEGMVVSS 200 S + RQE A+E+L + ++ +H+E+L L S E + +S+ Sbjct: 516 SEKGRQEDAEEYLGFILNGLHEEMLNLKKLLSPSNEKLTISN 557
>UBP2_HUMAN (O75604) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 605 Score = 30.4 bits (67), Expect = 1.3 Identities = 17/67 (25%), Positives = 34/67 (50%) Frame = +3 Query: 9 VINPTMFDQVLRNFTPDVPAGTSARPRQEHAQEFLSYAMDRMHDELLRLNGNGLNSKEGM 188 V++P+ F ++ + P Q+ AQEFL + +D +H+E+ R+ ++ E + Sbjct: 333 VVSPSEFKTQIQRYAPRFVGYN-----QQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENL 387 Query: 189 VVSSDDD 209 DD+ Sbjct: 388 DHLPDDE 394
>UBP10_MOUSE (P52479) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 792 Score = 30.0 bits (66), Expect = 1.7 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +3 Query: 60 VPAGTSARPRQEHAQEFLSYAMDRMHDELLRL 155 + + S + RQE A+E+L + ++ +H+E+L L Sbjct: 505 IKSSLSEKGRQEDAEEYLGFILNGLHEEMLSL 536
>PO2F1_RAT (P31503) POU domain, class 2, transcription factor 1| (Octamer-binding transcription factor 1) (Oct-1) (OTF-1) (NF-A1) (Fragment) Length = 632 Score = 29.6 bits (65), Expect = 2.2 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = -2 Query: 211 SSSSEETTIPSFEFKPLPLSLNSSSCILSMA*LRNSWACSCLGRADVPAGTS 56 +SS+ ET+ PLP L +S +++ + L+ + A + G A +PA S Sbjct: 426 ASSASETSTTQTTSTPLPSPLGASQVMVTASGLQTAAAAALQGAAQLPANAS 477
>CAC1H_HUMAN (O95180) Voltage-dependent T-type calcium channel alpha-1H subunit| (Voltage-gated calcium channel alpha subunit Cav3.2) (Low-voltage-activated calcium channel alpha1 3.2 subunit) Length = 2353 Score = 29.6 bits (65), Expect = 2.2 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 217 QASSSSEETTIPSFEFKPLPLSLNSSSCIL 128 QAS +E T+PSF F+PL L + S L Sbjct: 2253 QASCRAEHLTVPSFAFEPLDLGVPSGDPFL 2282
>UBP12_YEAST (P39538) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) Length = 1254 Score = 29.3 bits (64), Expect = 2.9 Identities = 16/65 (24%), Positives = 31/65 (47%) Frame = +3 Query: 18 PTMFDQVLRNFTPDVPAGTSARPRQEHAQEFLSYAMDRMHDELLRLNGNGLNSKEGMVVS 197 P+MF + +F + Q+ +QEFL++ +D +H++L R+ K + Sbjct: 440 PSMFKSTIGHFN-----SMFSGYMQQDSQEFLAFLLDSLHEDLNRIIKKEYTEKPSLSPG 494 Query: 198 SDDDD 212 D +D Sbjct: 495 DDVND 499
>UBP2_MOUSE (O88623) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 353 Score = 28.9 bits (63), Expect = 3.8 Identities = 17/67 (25%), Positives = 33/67 (49%) Frame = +3 Query: 9 VINPTMFDQVLRNFTPDVPAGTSARPRQEHAQEFLSYAMDRMHDELLRLNGNGLNSKEGM 188 V++P+ F ++ + P Q+ AQEFL + +D +H+E+ R+ S E + Sbjct: 81 VVSPSEFKTQIQRYAPRFMGYN-----QQDAQEFLRFLLDGLHNEVNRVAARPKASPETL 135 Query: 189 VVSSDDD 209 D++ Sbjct: 136 DHLPDEE 142
>CAC1H_MOUSE (O88427) Voltage-dependent T-type calcium channel alpha-1H subunit| (Voltage-gated calcium channel alpha subunit Cav3.2) Length = 2365 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 217 QASSSSEETTIPSFEFKPLPLSLNSSSCIL 128 QAS +E T+P+F F+PL + C L Sbjct: 2266 QASCRAEHLTVPNFAFEPLDMGGPGGDCFL 2295
>RPOP_AGABT (P33539) Probable DNA-directed RNA polymerase (EC 2.7.7.6)| Length = 1102 Score = 28.9 bits (63), Expect = 3.8 Identities = 8/25 (32%), Positives = 21/25 (84%) Frame = +3 Query: 75 SARPRQEHAQEFLSYAMDRMHDELL 149 S+ P++++ Q+F +YA++++ D+L+ Sbjct: 762 SSNPKEDYPQDFYTYALEKIRDKLI 786
>CAC1H_RAT (Q9EQ60) Voltage-dependent T-type calcium channel alpha-1H subunit| (Voltage-gated calcium channel alpha subunit Cav3.2) Length = 2359 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 217 QASSSSEETTIPSFEFKPLPLSLNSSSCIL 128 QAS +E T+P+F F+PL + C L Sbjct: 2260 QASCRAEHLTVPNFAFEPLDMGGPGGDCFL 2289
>LSP2_DROME (Q24388) Larval serum protein 2 precursor (LSP-2) (Hexamerin 2)| Length = 701 Score = 28.1 bits (61), Expect = 6.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -3 Query: 141 HHAFYPWHNLETLGHVLVLAEQMFQPVH 58 HH+FY HN E + HV + +++ +H Sbjct: 313 HHSFYHEHNYEHIEHVEMYTQRVMDWIH 340
>MUC5A_HUMAN (P98088) Mucin-5AC (Mucin 5 subtype AC, tracheobronchial)| (Tracheobronchial mucin) (TBM) (Major airway glycoprotein) (Fragment) Length = 1233 Score = 27.7 bits (60), Expect = 8.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 59 CTGWNICSAKTRTCPRVSK 115 C G N+ S RTCPRV K Sbjct: 454 CEGNNVISLSPRTCPRVEK 472
>UBP12_SCHPO (O60079) Probable ubiquitin carboxyl-terminal hydrolase 12 (EC| 3.1.2.15) (Ubiquitin thioesterase 12) (Ubiquitin-specific processing protease 12) (Deubiquitinating enzyme 12) Length = 979 Score = 27.7 bits (60), Expect = 8.4 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +3 Query: 90 QEHAQEFLSYAMDRMHDELLRLNGNGLNSK 179 Q+ +QEFL++ +D +H++L R+ SK Sbjct: 400 QQDSQEFLAFLLDGLHEDLNRIYQKPYTSK 429
>UBP1_SCHPO (Q9USM5) Probable ubiquitin carboxyl-terminal hydrolase 1 (EC| 3.1.2.15) (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) Length = 849 Score = 27.7 bits (60), Expect = 8.4 Identities = 9/23 (39%), Positives = 19/23 (82%) Frame = +3 Query: 87 RQEHAQEFLSYAMDRMHDELLRL 155 RQ+ +QEF+++ +D +H++L R+ Sbjct: 368 RQQDSQEFIAFFLDGLHEDLNRI 390 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,421,156 Number of Sequences: 219361 Number of extensions: 592121 Number of successful extensions: 1673 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1672 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)