| Clone Name | bast47b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CCDC4_HUMAN (Q6ZU67) Coiled-coil domain-containing protein 4 | 31 | 1.6 | 2 | FBRL_NEUCR (Q9HE26) Fibrillarin | 30 | 2.8 | 3 | MUCDL_HUMAN (Q9HBB8) Mucin and cadherin-like protein precursor (... | 30 | 3.6 |
|---|
>CCDC4_HUMAN (Q6ZU67) Coiled-coil domain-containing protein 4| Length = 530 Score = 30.8 bits (68), Expect = 1.6 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +1 Query: 19 PIPHPPYDPRRAQKILVAILSSSHPGEE---EASRSPEKGRSSPRISSLREICTERAGEG 189 P P PP+ P A V+I SS P ++ ++S P GR++ SS CT +G Sbjct: 52 PPPPPPFAPHAA----VSISSSEPPPQQFQAQSSYPPGPGRAAAAASSSSPSCTPATSQG 107 Query: 190 SI 195 + Sbjct: 108 HL 109
>FBRL_NEUCR (Q9HE26) Fibrillarin| Length = 323 Score = 30.0 bits (66), Expect = 2.8 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 153 GGDPRGRAPLLGGSRGFFFPGVGGG 79 GGD GR GGSRG F G GGG Sbjct: 20 GGDRGGRGGARGGSRGGFGGGRGGG 44
>MUCDL_HUMAN (Q9HBB8) Mucin and cadherin-like protein precursor| (Mu-protocadherin) Length = 845 Score = 29.6 bits (65), Expect = 3.6 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 4/65 (6%) Frame = +1 Query: 7 NWSAPIPHPPYDPRRAQKILVAILSSSHPGEEEASRSPE---KGRSSPRISSLREICT-E 174 NW AP+P P +DP+ A+ + A + PG +PE R+ +++R I T E Sbjct: 725 NW-APVPSPTHDPKPAEAPMPA--EPAPPGPASPGGAPEPPAAARAGGSPTAVRSILTKE 781 Query: 175 RAGEG 189 R EG Sbjct: 782 RRPEG 786 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,876,311 Number of Sequences: 219361 Number of extensions: 614961 Number of successful extensions: 2114 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2021 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2111 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)