| Clone Name | bast47b01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | APG_BRANA (P40603) Anter-specific proline-rich protein APG (Prot... | 47 | 8e-06 | 2 | APG_ARATH (P40602) Anter-specific proline-rich protein APG precu... | 47 | 1e-05 | 3 | SFAH_HELAN (P81098) Seed fatty acyl-ester hydrolase (EC 3.1.1.1)... | 38 | 0.005 | 4 | THIO_RHIET (O34292) Putative thiamine biosynthesis oxidoreductas... | 28 | 7.0 |
|---|
>APG_BRANA (P40603) Anter-specific proline-rich protein APG (Protein CEX)| (Fragment) Length = 449 Score = 47.4 bits (111), Expect = 8e-06 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +1 Query: 271 VPCYFIFGDSLVDNGNNNYIVSLTRANYPPYGIDFAGG 384 +P F FGDS+ D GNNN + + + NY PYG+DF G Sbjct: 123 IPAVFFFGDSIFDTGNNNNLDTKLKCNYRPYGMDFPMG 160
>APG_ARATH (P40602) Anter-specific proline-rich protein APG precursor| Length = 534 Score = 47.0 bits (110), Expect = 1e-05 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = +1 Query: 271 VPCYFIFGDSLVDNGNNNYIVSLTRANYPPYGIDF 375 +P F FGDS+ D GNNN + + ++NY PYG+DF Sbjct: 202 IPAVFFFGDSVFDTGNNNNLETKIKSNYRPYGMDF 236
>SFAH_HELAN (P81098) Seed fatty acyl-ester hydrolase (EC 3.1.1.1) (Fragment)| Length = 18 Score = 38.1 bits (87), Expect = 0.005 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 262 DPQVPCYFIFGDSLVDNG 315 DPQVP YFIFGDSL DNG Sbjct: 1 DPQVPXYFIFGDSLYDNG 18
>THIO_RHIET (O34292) Putative thiamine biosynthesis oxidoreductase thiO| Length = 327 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 129 LVATARHTGSAEEIDRWTRRREKWKWI 49 +VA R TG E+DR++RR W+W+ Sbjct: 86 VVAGGRDTG---ELDRFSRRTSGWEWL 109 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,815,153 Number of Sequences: 219361 Number of extensions: 403895 Number of successful extensions: 795 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 794 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)