| Clone Name | bast47a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YIHM_ECOLI (P32134) Hypothetical protein yihM | 30 | 3.3 | 2 | ACOX_KLULA (Q6CKK7) Acyl-coenzyme A oxidase (EC 1.3.3.6) (Acyl-C... | 29 | 4.3 | 3 | RL25_ZYMMO (Q5NL76) 50S ribosomal protein L25 (General stress pr... | 28 | 7.4 |
|---|
>YIHM_ECOLI (P32134) Hypothetical protein yihM| Length = 326 Score = 29.6 bits (65), Expect = 3.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 338 DAEVVADPVGQGHESHVRGHGGAEGRALLLH 246 DA +V +P G GH++ + G G +ALL H Sbjct: 207 DALIVKEPGGLGHKACISGQGDMPFKALLTH 237
>ACOX_KLULA (Q6CKK7) Acyl-coenzyme A oxidase (EC 1.3.3.6) (Acyl-CoA oxidase)| Length = 736 Score = 29.3 bits (64), Expect = 4.3 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 234 PRRFMQEQRPAFRPAVPPDVGFMPLADRIRDHLGVSFPRINL 359 PR+FM ++ P PP V PL D+I + + R+N+ Sbjct: 294 PRQFMLQRFTKVIPGSPPKVQTQPLLDQISGYSALLSGRVNM 335
>RL25_ZYMMO (Q5NL76) 50S ribosomal protein L25 (General stress protein CTC)| Length = 220 Score = 28.5 bits (62), Expect = 7.4 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 273 PAVPPDVGFMPLADRIRDHLGVSFPRINLDGLV 371 P +P DV F P+ DR+ L V F R++ + LV Sbjct: 74 PTIPKDVQFHPVTDRV---LHVDFLRVSANSLV 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,606,995 Number of Sequences: 219361 Number of extensions: 467913 Number of successful extensions: 1410 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1410 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)