| Clone Name | bast46h03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CHLP_SYNY3 (Q55087) Geranylgeranyl hydrogenase | 72 | 4e-13 | 2 | BCHP_RHOCA (P26172) Geranylgeranyl hydrogenase | 38 | 0.005 | 3 | RNZ_MYCLE (Q49744) Putative ribonuclease Z (EC 3.1.26.11) (RNase... | 28 | 5.3 |
|---|
>CHLP_SYNY3 (Q55087) Geranylgeranyl hydrogenase| Length = 407 Score = 71.6 bits (174), Expect = 4e-13 Identities = 30/57 (52%), Positives = 43/57 (75%) Frame = +2 Query: 209 QAFLLERSPAGAKPCGGAIPLCMLDEFAIPLGLVDRRVTRMRVLSPSNLAADFGRAL 379 + +L ER AKPCGGAIPLCM+DEF +P ++DRRV +M+++SPSN+ + G+ L Sbjct: 27 ETYLFERKLDNAKPCGGAIPLCMVDEFDLPPEIIDRRVRKMKMISPSNIEVNIGQTL 83
>BCHP_RHOCA (P26172) Geranylgeranyl hydrogenase| Length = 391 Score = 38.1 bits (87), Expect = 0.005 Identities = 20/49 (40%), Positives = 31/49 (63%) Frame = +2 Query: 218 LLERSPAGAKPCGGAIPLCMLDEFAIPLGLVDRRVTRMRVLSPSNLAAD 364 LL+R+ KPCGGAIP ++ +F IP L+ ++T R++SP+ D Sbjct: 30 LLDRA-GRIKPCGGAIPPRLIRDFDIPDHLLVAKITSARMISPTGRFVD 77
>RNZ_MYCLE (Q49744) Putative ribonuclease Z (EC 3.1.26.11) (RNase Z) (tRNase| Z) (tRNA 3 endonuclease) Length = 220 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/56 (26%), Positives = 22/56 (39%) Frame = +2 Query: 215 FLLERSPAGAKPCGGAIPLCMLDEFAIPLGLVDRRVTRMRVLSPSNLAADFGRALP 382 F +E P GG +P LDE A + + R ++ + AD G P Sbjct: 139 FRIESGPTSVVLTGGTVPCASLDELAAEADALVHTIIRKNIVIRVHQQADQGHLQP 194 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.134 0.475 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,720,651 Number of Sequences: 219361 Number of extensions: 306612 Number of successful extensions: 932 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 931 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)