| Clone Name | bast46g01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PK1IP_MOUSE (Q9DCE5) p21-activated protein kinase-interacting pr... | 30 | 1.1 | 2 | POLG_ZYMVR (Q89330) Genome polyprotein [Contains: P1 proteinase ... | 27 | 9.2 |
|---|
>PK1IP_MOUSE (Q9DCE5) p21-activated protein kinase-interacting protein 1| (PAK1-interacting protein 1) (Putative PAK inhibitor Skb15) Length = 382 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +2 Query: 5 LPPSLQPTPDQLGN*QRQSLQGVQRHTADRASGKNGGVTERSEPT 139 LPP+ +P PDQ +++S VQ T++ S K+ + +PT Sbjct: 313 LPPAAEPCPDQPKTIEKESGDTVQEETSEPNSEKSDVSGDSKQPT 357
>POLG_ZYMVR (Q89330) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral ge Length = 3083 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 137 SALSAP*RRHSCRSLDRLYAVEPPVGSASASCLVDRVL 24 S+L +P + SCR + E V SAS + L DRVL Sbjct: 150 SSLRSPFYKRSCRKEKKKIVCENVVRSASVNNLCDRVL 187 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.122 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,467,685 Number of Sequences: 219361 Number of extensions: 427198 Number of successful extensions: 872 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)