| Clone Name | bast46f11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HDAC4_CHICK (P83038) Histone deacetylase 4 (HD4) | 29 | 4.4 | 2 | RPC1_TRYBB (P08968) DNA-directed RNA polymerase III largest subu... | 28 | 7.6 | 3 | ADEC_DEIRA (Q9RYP0) Adenine deaminase (EC 3.5.4.2) (Adenase) (Ad... | 28 | 9.9 | 4 | G3PB_SPIOL (P12860) Glyceraldehyde-3-phosphate dehydrogenase B, ... | 28 | 9.9 |
|---|
>HDAC4_CHICK (P83038) Histone deacetylase 4 (HD4)| Length = 1080 Score = 29.3 bits (64), Expect = 4.4 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -2 Query: 409 HRRGRRQLGGARHAHAGQTEVLRVGQQDEDGQ-RREVDRHRPEQDLHQE 266 H + RQ H H Q E+L + Q E + +R++++HR EQ+L ++ Sbjct: 97 HEQLSRQHEAQLHEHIKQQEMLAMKHQQELLEHQRKLEQHRQEQELEKQ 145
>RPC1_TRYBB (P08968) DNA-directed RNA polymerase III largest subunit (EC| 2.7.7.6) Length = 1530 Score = 28.5 bits (62), Expect = 7.6 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = -2 Query: 415 AHHRRGRRQLGGARHAHAGQTEVLRVGQQDEDGQRREVDRHR 290 A+H RR + H H G T V + + + E DRHR Sbjct: 402 ANHELMRRLVRNGPHVHPGATTVYLAQEGSKKSLKNERDRHR 443
>ADEC_DEIRA (Q9RYP0) Adenine deaminase (EC 3.5.4.2) (Adenase) (Adenine aminase)| Length = 536 Score = 28.1 bits (61), Expect = 9.9 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +1 Query: 313 AGHPHPADQRAVLRSDRRERAARHQAGVVRAGGERDEVL 429 AG HPAD A++ S E H GV+ G D VL Sbjct: 313 AGGLHPADAVALVTSQPAEYWGLHDLGVIAPGYHADFVL 351
>G3PB_SPIOL (P12860) Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast| precursor (EC 1.2.1.13) (NADP-dependent glyceraldehydephosphate dehydrogenase subunit B) Length = 451 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +2 Query: 314 LAILILLTNAQYFGLTGVSVPRATKLASSAPVVSVMKYCDI 436 ++++ L+ N + G+T V A + A++ P+ V+ CDI Sbjct: 325 VSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDI 365 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,616,851 Number of Sequences: 219361 Number of extensions: 742929 Number of successful extensions: 2695 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2690 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)