| Clone Name | bast46e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CI038_HUMAN (Q9UI66) Protein C9orf38 | 28 | 7.0 | 2 | SOX12_HUMAN (O15370) SOX-12 protein (SOX-22 protein) | 28 | 7.0 | 3 | POLB_CHPVE (Q04350) ORFB polyprotein [Contains: Papain-like prot... | 27 | 9.2 | 4 | POLB_CHPVU (Q9YTU2) ORFB polyprotein [Contains: Papain-like prot... | 27 | 9.2 |
|---|
>CI038_HUMAN (Q9UI66) Protein C9orf38| Length = 118 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 123 LLCFIPLACSAPSWFSGVVWC 61 L+ F+PL SWFS ++WC Sbjct: 83 LMRFLPLQRHTRSWFSLILWC 103
>SOX12_HUMAN (O15370) SOX-12 protein (SOX-22 protein)| Length = 315 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -1 Query: 250 YGAGSQRPRRSL-YTTGTAWVASWLASSGG 164 +GAG +RPR ++ TT + W +W GG Sbjct: 155 WGAGRRRPRTTMKTTTRSCWKCAWSRPRGG 184
>POLB_CHPVE (Q04350) ORFB polyprotein [Contains: Papain-like protease p48 (EC| 3.4.22.-); Putative RNA-directed RNA polymerase/Helicase (EC 2.7.7.48) (EC 3.6.1.-)] Length = 3165 Score = 27.3 bits (59), Expect = 9.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 271 RRLTWEGYGAGSQRP 227 +R+TWE YGAGS P Sbjct: 1872 KRITWETYGAGSGMP 1886
>POLB_CHPVU (Q9YTU2) ORFB polyprotein [Contains: Papain-like protease p48 (EC| 3.4.22.-); Putative RNA-directed RNA polymerase/Helicase (EC 2.7.7.48) (EC 3.6.1.-)] Length = 3164 Score = 27.3 bits (59), Expect = 9.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 271 RRLTWEGYGAGSQRP 227 +R+TWE YGAGS P Sbjct: 1871 KRITWETYGAGSGMP 1885 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,554,974 Number of Sequences: 219361 Number of extensions: 525309 Number of successful extensions: 1296 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1272 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1294 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)