| Clone Name | bast46e08 |
|---|---|
| Clone Library Name | barley_pub |
>APG_BRANA (P40603) Anter-specific proline-rich protein APG (Protein CEX)| (Fragment) Length = 449 Score = 57.8 bits (138), Expect = 1e-08 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +3 Query: 267 VPAMFVFGDSLTDNGNNNDLTSLAKANYLPYGIDF-AGGPTGRFS 398 +PA+F FGDS+ D GNNN+L + K NY PYG+DF G TGRFS Sbjct: 123 IPAVFFFGDSIFDTGNNNNLDTKLKCNYRPYGMDFPMGVATGRFS 167
>APG_ARATH (P40602) Anter-specific proline-rich protein APG precursor| Length = 534 Score = 54.7 bits (130), Expect = 1e-07 Identities = 26/45 (57%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +3 Query: 267 VPAMFVFGDSLTDNGNNNDLTSLAKANYLPYGIDFA-GGPTGRFS 398 +PA+F FGDS+ D GNNN+L + K+NY PYG+DF TGRFS Sbjct: 202 IPAVFFFGDSVFDTGNNNNLETKIKSNYRPYGMDFKFRVATGRFS 246
>FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51)| (Alpha-L-fucoside fucohydrolase 2) (Alpha-1,2-fucosidase) (AtFXG1) Length = 372 Score = 31.2 bits (69), Expect = 1.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +3 Query: 270 PAMFVFGDSLTDNGNNNDLTSLAKANYLPYGIDFAGGPTGRF 395 PA+F FGDS +D G L++ P+G F G P GR+ Sbjct: 29 PAIFNFGDSNSDTGG---LSAAFGQAGPPHGSSFFGSPAGRY 67
>LIP1_PHOLU (P40601) Lipase 1 precursor (EC 3.1.1.3) (Triacylglycerol lipase)| Length = 645 Score = 28.5 bits (62), Expect = 7.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 276 MFVFGDSLTDNGNNNDLT 329 ++VFGDSL+D GNN T Sbjct: 28 LYVFGDSLSDGGNNGRYT 45
>EST_HEVBR (Q7Y1X1) Esterase precursor (EC 3.1.1.-) (Early nodule-specific| protein homolog) (Latex allergen Hev b 13) Length = 391 Score = 28.5 bits (62), Expect = 7.6 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +3 Query: 270 PAMFVFGDSLTDNGNNNDLTSLAKANY---LPYGIDFAGGPTGRFS 398 PA+F FGDS +D G A A Y PYG F TGR+S Sbjct: 33 PAIFNFGDSNSDTGGK------AAAFYPLNPPYGETFFHRSTGRYS 72
>ISL3_BRARE (P53407) Insulin gene enhancer protein isl-3 (Islet-3)| Length = 358 Score = 28.1 bits (61), Expect = 9.9 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -2 Query: 436 QKLSYGVDHGVAVEKRPVGPP-AKSMP*GR*LALASDVRSLLLPLSVRESPNTN 278 ++L DHG+A+E+ P G P + R L +A+D P+SVR++P+ N Sbjct: 135 EELLCRADHGLALERGPGGSPLSPGNIHTRGLHMAAD------PVSVRQTPHRN 182
>SFAH_HELAN (P81098) Seed fatty acyl-ester hydrolase (EC 3.1.1.1) (Fragment)| Length = 18 Score = 28.1 bits (61), Expect = 9.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 267 VPAMFVFGDSLTDNG 311 VP F+FGDSL DNG Sbjct: 4 VPXYFIFGDSLYDNG 18 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,225,425 Number of Sequences: 219361 Number of extensions: 559103 Number of successful extensions: 1506 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1505 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)