| Clone Name | bast46c11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UNC52_CAEEL (Q06561) Basement membrane proteoglycan precursor (P... | 30 | 1.4 | 2 | ARLY_ANSAN (P33110) Argininosuccinate lyase (EC 4.3.2.1) (Argino... | 27 | 9.2 |
|---|
>UNC52_CAEEL (Q06561) Basement membrane proteoglycan precursor (Perlecan| homolog) (Uncoordinated protein 52) Length = 3375 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 108 AGGGKDDELADLVRRIVDVLSRYSDRLPFDLDRQ 209 +G G D+ AD++ R D+ +Y R PF DR+ Sbjct: 816 SGNGNSDQSADVILRGNDIALQYKHREPFYADRE 849
>ARLY_ANSAN (P33110) Argininosuccinate lyase (EC 4.3.2.1) (Arginosuccinase)| (ASAL) (Delta crystallin) Length = 466 Score = 27.3 bits (59), Expect = 9.2 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +3 Query: 120 KDDELADLVRRIVDVLSRYSDRL---PFDLDRQKLRSLTTLAAIAI 248 +D E V+R ++VL S L P D+DR+ LRS A+I++ Sbjct: 182 RDSERLGEVKRRINVLPLGSGALAGNPLDIDREMLRSELDFASISL 227 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,693,340 Number of Sequences: 219361 Number of extensions: 262630 Number of successful extensions: 624 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 624 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)