| Clone Name | bast46c02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CYLD_HUMAN (Q9NQC7) Probable ubiquitin carboxyl-terminal hydrola... | 29 | 5.3 | 2 | TPIC_SECCE (P46225) Triosephosphate isomerase, chloroplast precu... | 28 | 6.9 | 3 | JAK3_MOUSE (Q62137) Tyrosine-protein kinase JAK3 (EC 2.7.10.2) (... | 28 | 6.9 |
|---|
>CYLD_HUMAN (Q9NQC7) Probable ubiquitin carboxyl-terminal hydrolase CYLD (EC| 3.1.2.15) (Ubiquitin thioesterase CYLD) (Ubiquitin-specific-processing protease CYLD) (Deubiquitinating enzyme CYLD) Length = 956 Score = 28.9 bits (63), Expect = 5.3 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 182 CCTLVLLQRKKVER-ERRRGCSAGRKEREENLNLLFSH 292 C T ++ RK +E+ E G ++ K+ EE LN+LF H Sbjct: 655 CATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHH 692
>TPIC_SECCE (P46225) Triosephosphate isomerase, chloroplast precursor (EC| 5.3.1.1) (TIM) (Triose-phosphate isomerase) Length = 298 Score = 28.5 bits (62), Expect = 6.9 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = -2 Query: 382 SSESRQAAAQGITQVSRRGRGQTRGNWGWSMTEEQIQILFSLLSSCT 242 S+ + AAAQ + ++ G+ GNW + T+E I L S L++ T Sbjct: 29 SASAAPAAAQRLVAMAGSGKFFVGGNWKCNGTKESISKLVSDLNAAT 75
>JAK3_MOUSE (Q62137) Tyrosine-protein kinase JAK3 (EC 2.7.10.2) (Janus kinase| 3) (JAK-3) Length = 1299 Score = 28.5 bits (62), Expect = 6.9 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = -2 Query: 415 QDGGKRVTRGESSESRQAAAQGITQVSR--RGRGQTRG-NWGWSMTEEQIQILFSLLSS 248 Q GG + G E Q G+T+ R RGRG+T G + W + + +FS L+S Sbjct: 323 QGGGVNLKVGPGMELPQGLTWGVTRRVRLDRGRGRTEGDSMDWISGHDPTRPVFSPLTS 381 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,763,062 Number of Sequences: 219361 Number of extensions: 533230 Number of successful extensions: 1460 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1459 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)