| Clone Name | bast46c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TAUB_YERPS (Q664P8) Taurine import ATP-binding protein tauB (EC ... | 32 | 0.91 | 2 | TAUB_YERPE (Q8ZJD0) Taurine import ATP-binding protein tauB (EC ... | 32 | 0.91 |
|---|
>TAUB_YERPS (Q664P8) Taurine import ATP-binding protein tauB (EC 3.6.3.36)| Length = 255 Score = 31.6 bits (70), Expect = 0.91 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = -1 Query: 156 GSSQSQRRLTALFVVGIWGLACFSAPVVGKNAGGEEQVVGI 34 G S+ QRR+TAL ++ GLA F + + +GG Q VGI Sbjct: 99 GMSKEQRRVTALKMLNRVGLAGFEHHFIWQLSGGMRQRVGI 139
>TAUB_YERPE (Q8ZJD0) Taurine import ATP-binding protein tauB (EC 3.6.3.36)| Length = 255 Score = 31.6 bits (70), Expect = 0.91 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = -1 Query: 156 GSSQSQRRLTALFVVGIWGLACFSAPVVGKNAGGEEQVVGI 34 G S+ QRR+TAL ++ GLA F + + +GG Q VGI Sbjct: 99 GMSKEQRRVTALKMLNRVGLAGFEHHFIWQLSGGMRQRVGI 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,613,643 Number of Sequences: 219361 Number of extensions: 933736 Number of successful extensions: 2559 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2559 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)