| Clone Name | bast44h09 |
|---|---|
| Clone Library Name | barley_pub |
>YB79_YEAST (P38138) Putative family 31 glucosidase in FAT2-PBP2 intergenic| region (EC 3.2.1.-) Length = 954 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -2 Query: 163 TGRPWSPPWRSWGARRCGWSGVPWRSIYSIESGVD 59 TGRP+ PP S G +C W+ + +++S +D Sbjct: 379 TGRPFLPPISSIGYHQCRWNYNDEMDVLTVDSQMD 413
>YAAX_ECOLI (P75616) Hypothetical protein yaaX precursor| Length = 98 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = +3 Query: 93 HGTPDQP--HRLAPHERHGGDHG 155 HG P P H+ APH+ HGG HG Sbjct: 71 HGPPPPPRHHKKAPHDHHGG-HG 92
>POLG_HCVJL (Q68798) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3021 Score = 28.5 bits (62), Expect = 4.1 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = -2 Query: 163 TGRPWSPP---WRSWGARRCGWSG 101 TGR W P W +G CGW+G Sbjct: 71 TGRAWGQPGYAWPLYGNEGCGWAG 94
>POLG_HCVVN (O92530) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3012 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = -2 Query: 163 TGRPWSPP---WRSWGARRCGWSG 101 TGR W+ P W +G CGW G Sbjct: 71 TGRTWAQPGYPWPLYGNEGCGWMG 94
>POLG_HCVEU (O39927) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3017 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/23 (43%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = -2 Query: 160 GRPWSPP---WRSWGARRCGWSG 101 GR W+ P W +G+ CGW+G Sbjct: 72 GRHWAQPGYPWPLYGSEGCGWAG 94
>NFKB2_CHICK (P98150) Nuclear factor NF-kappa-B p100 subunit (Nuclear factor| NF-kappa-B p97 subunit) (DNA-binding factor KBF2) (Lyt-10) [Contains: Nuclear factor NF-kappa-B p52 subunit (Nuclear factor NF-kappa-B p50B subunit)] Length = 906 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 10 SSQARPPTLIHCPAPPRRHHSLYYRSNAM 96 +SQ PP ++ CP PP R+H L ++A+ Sbjct: 755 ASQPSPP-ILSCPPPPSRNHLLSLDTDAL 782
>PSARL_PONPY (Q5R5H4) Presenilins-associated rhomboid-like protein,| mitochondrial precursor (EC 3.4.21.105) (Mitochondrial intramembrane-cleaving protease PARL) [Contains: P-beta (Pbeta)] Length = 379 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 3/26 (11%) Frame = -1 Query: 77 YREWCRRG-GAGQ*M--SVGGRACEE 9 +R W +RG G GQ SVGGR+CEE Sbjct: 3 WRGWAQRGWGCGQAWAASVGGRSCEE 28
>PSARL_HUMAN (Q9H300) Presenilins-associated rhomboid-like protein,| mitochondrial precursor (EC 3.4.21.105) (Mitochondrial intramembrane cleaving protease PARL) [Contains: P-beta (Pbeta)] Length = 379 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 3/26 (11%) Frame = -1 Query: 77 YREWCRRG-GAGQ*M--SVGGRACEE 9 +R W +RG G GQ SVGGR+CEE Sbjct: 3 WRGWAQRGWGCGQAWGASVGGRSCEE 28
>DLGP1_MOUSE (Q9D415) Disks large-associated protein 1 (DAP-1) (Guanylate| kinase-associated protein) (SAP90/PSD-95-associated protein 1) (SAPAP1) (PSD-95/SAP90-binding protein 1) Length = 992 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +3 Query: 12 LAGSPSYTHSLSRSAPSTPLSIL*IERHGTPDQPHRLAPHERHGGDH 152 L+GS S+ H ++ A LS H + +P+ L+P + H DH Sbjct: 4 LSGSRSHHHGITCEAACDSLS------HHSDHKPYLLSPVDHHPADH 44
>ATX1_HUMAN (P54253) Ataxin-1 (Spinocerebellar ataxia type 1 protein)| Length = 816 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 19 ARPPTLIHCPAPPRRHHSLYYRSNAMARRTNHTASPP 129 +R P LI +PP + Y ++ + T TASPP Sbjct: 229 SRAPGLITPGSPPPAQQNQYVHISSSPQNTGRTASPP 265
>POLG_HCVJP (Q9DHD6) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3032 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/24 (41%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = -2 Query: 163 TGRPWSPP---WRSWGARRCGWSG 101 TG+ W P W +G CGW+G Sbjct: 71 TGKSWGKPGYPWPLYGNEGCGWAG 94
>POLG_HCVJ8 (P26661) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3032 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/24 (41%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = -2 Query: 163 TGRPWSPP---WRSWGARRCGWSG 101 TG+ W P W +G CGW+G Sbjct: 71 TGKSWGKPGYPWPLYGNEGCGWAG 94
>POLG_HCVJ7 (P27961) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70)] (Fragment) Length = 736 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/24 (41%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = -2 Query: 163 TGRPWSPP---WRSWGARRCGWSG 101 TG+ W P W +G CGW+G Sbjct: 71 TGKSWGKPGYPWPLYGNEGCGWAG 94
>K1196_HUMAN (Q96KM6) Zinc finger protein KIAA1196| Length = 892 Score = 27.3 bits (59), Expect = 9.1 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +1 Query: 22 RPPTLIHCPAPPRRHHSLYYRSNA---MARRTNHTASPPMNAT 141 +PP + P+ P H YRS A R+ HTA PP T Sbjct: 620 KPPCEVDSPSFPCTHCGKTYRSKAGHDYHVRSEHTAPPPEEPT 662 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,292,231 Number of Sequences: 219361 Number of extensions: 499898 Number of successful extensions: 1639 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1636 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)