| Clone Name | bast44h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MYSC_CHICK (P29616) Myosin heavy chain, cardiac muscle isoform (... | 28 | 5.2 | 2 | GPMI_WOLPM (Q73GR4) 2,3-bisphosphoglycerate-independent phosphog... | 28 | 6.8 |
|---|
>MYSC_CHICK (P29616) Myosin heavy chain, cardiac muscle isoform (Fragment)| Length = 1102 Score = 28.1 bits (61), Expect = 5.2 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +3 Query: 15 SHAHRHHPFSCGAARGFRGERKLAMAEQPHAEDAGHKPETLMEKIA 152 SHA+RH + +ARG + + K Q +D GH E L E++A Sbjct: 796 SHANRHAAEATKSARGLQTQIK---ELQVQLDDLGHLNEDLKEQLA 838
>GPMI_WOLPM (Q73GR4) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) Length = 506 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +3 Query: 18 HAHRHHPFSCGAARGFRGERKLAMAEQPHAEDAGHKPE----TLMEKIADKLH 164 +AH F+CG F GE ++ + P + +PE L EK+ +K+H Sbjct: 324 YAHVTFFFNCGKEEPFSGEERI-LIPSPKVQTYDLQPEMSAFELTEKLVEKIH 375 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,620,413 Number of Sequences: 219361 Number of extensions: 291320 Number of successful extensions: 1322 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1319 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)