| Clone Name | bast44g12 |
|---|---|
| Clone Library Name | barley_pub |
>COFA1_MOUSE (O35206) Collagen alpha-1(XV) chain precursor [Contains: Endostatin| (Endostatin-XV)] Length = 1367 Score = 32.3 bits (72), Expect = 0.36 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -2 Query: 121 PPAEP-FPGLAGR*AEKITLPEAPAGVSGLP 32 PP P +PGL G+ E + P+ P G+ GLP Sbjct: 1033 PPGLPGYPGLVGQKGEAVVGPQGPPGIPGLP 1063
>US10_EHV4 (P18349) 28 kDa protein (ORF3)| Length = 259 Score = 30.8 bits (68), Expect = 1.0 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 11 VAVDGDVRKSGDAGGGLG 64 +AVDGDVR GD GGG G Sbjct: 40 MAVDGDVRTGGDCGGGEG 57
>MDC1_MACMU (Q5TM68) Mediator of DNA damage checkpoint protein 1| Length = 2173 Score = 28.5 bits (62), Expect = 5.2 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -3 Query: 126 PYLRLNRFQGWQAVKQKR*LFPRPPPASPDFLTSPSTAT 10 P R +R Q W AV+ L P PASP L P+ A+ Sbjct: 1832 PKSRPSRNQRWGAVRADESLTAIPEPASPQLLDIPTHAS 1870
>MDC1_PANTR (Q7YR40) Mediator of DNA damage checkpoint protein 1| Length = 2171 Score = 27.7 bits (60), Expect = 8.8 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 126 PYLRLNRFQGWQAVKQKR*LFPRPPPASPDFLTSPSTAT 10 P + +R Q W AV+ L P PASP L +P A+ Sbjct: 1830 PKSQASRNQRWGAVRAAESLTAIPEPASPQLLETPIHAS 1868
>COFA1_HUMAN (P39059) Collagen alpha-1(XV) chain precursor [Contains: Endostatin| (Endostatin-XV) (Restin) (Related to endostatin)] Length = 1388 Score = 27.7 bits (60), Expect = 8.8 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -2 Query: 121 PPAEPF-PGLAGR*AEKITLPEAPAGVSGLP 32 PP P PG AG+ E + P+ P G GLP Sbjct: 1054 PPGLPGNPGPAGQKGETVVGPQGPPGAPGLP 1084
>MDC1_HUMAN (Q14676) Mediator of DNA damage checkpoint protein 1 (Nuclear factor| with BRCT domains 1) Length = 2089 Score = 27.7 bits (60), Expect = 8.8 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 126 PYLRLNRFQGWQAVKQKR*LFPRPPPASPDFLTSPSTAT 10 P + +R Q W AV+ L P PASP L +P A+ Sbjct: 1748 PKSQASRNQRWGAVRAAESLTAIPEPASPQLLETPIHAS 1786 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,629,901 Number of Sequences: 219361 Number of extensions: 565093 Number of successful extensions: 1478 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1478 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)