| Clone Name | bast44g01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SMCA2_HUMAN (P51531) Probable global transcription activator SNF... | 32 | 0.29 | 2 | SMCA4_HUMAN (P51532) Probable global transcription activator SNF... | 29 | 2.4 |
|---|
>SMCA2_HUMAN (P51531) Probable global transcription activator SNF2L2 (EC| 3.6.1.-) (ATP-dependent helicase SMARCA2) (SNF2-alpha) (SWI/SNF-related matrix associated actin dependent regulator of chromatin subfamily A member 2) (hBRM) Length = 1586 Score = 32.3 bits (72), Expect = 0.29 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 236 PAPFTAAQYEELEQQALIYKYLVAGVPVPQ 325 P+PF+ Q +L Q L YK L G P+P+ Sbjct: 171 PSPFSPVQLHQLRAQILAYKMLARGQPLPE 200
>SMCA4_HUMAN (P51532) Probable global transcription activator SNF2L4 (EC| 3.6.1.-) (ATP-dependent helicase SMARCA4) (SNF2-beta) (BRG-1 protein) (Mitotic growth and transcription activator) (Brahma protein homolog 1) (SWI/SNF-related matrix-associated actin Length = 1647 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 236 PAPFTAAQYEELEQQALIYKYLVAGVPVP 322 P PF Q +L Q + YK L G P+P Sbjct: 169 PTPFNQNQLHQLRAQIMAYKMLARGQPLP 197 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,130,097 Number of Sequences: 219361 Number of extensions: 277311 Number of successful extensions: 882 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 826 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)