| Clone Name | bast44f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DYR1B_HUMAN (Q9Y463) Dual specificity tyrosine-phosphorylation-r... | 30 | 1.5 | 2 | PHLPP_MOUSE (Q8CHE4) PH domain leucine-rich repeat-containing pr... | 28 | 4.5 | 3 | GAI1_VITVI (Q8S4W7) DELLA protein GAI1 (Gibberellic acid-insensi... | 28 | 4.5 | 4 | BRO1_USTMA (Q4PHA8) Vacuolar protein-sorting protein BRO1 (BRO d... | 28 | 7.7 |
|---|
>DYR1B_HUMAN (Q9Y463) Dual specificity tyrosine-phosphorylation-regulated kinase| 1B (EC 2.7.12.1) (Mirk protein kinase) (Minibrain-related kinase) Length = 629 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 18 CCAPHPAPSTYHFHSSAAATRGTAG 92 C PHPAP+ H +SA TR T G Sbjct: 575 CSPPHPAPAPQHPAASALRTRMTGG 599
>PHLPP_MOUSE (Q8CHE4) PH domain leucine-rich repeat-containing protein phosphatase| (EC 3.1.3.16) (PH domain leucine-rich repeat protein phosphatase) (Pleckstrin homology domain-containing family E protein 1) (Suprachiasmatic nucleus circadian oscillatory Length = 1687 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +1 Query: 193 QLHQVQLRAQRRPPQPHVPSAAADRQDALQPHPLRH 300 Q Q Q + Q+ PP P P Q QP P RH Sbjct: 1638 QEQQQQQQQQQLPPPPQPPQPQPQPQPQPQPQPQRH 1673
>GAI1_VITVI (Q8S4W7) DELLA protein GAI1 (Gibberellic acid-insensitive mutant| protein 1) (VvGAI1) Length = 590 Score = 28.5 bits (62), Expect = 4.5 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 6/39 (15%) Frame = +2 Query: 200 TKFNSALNAGLLNPMSPPPLPIDKTRSS------PTLFD 298 ++FN N L NP PP P+D T S P++FD Sbjct: 96 SEFNPTPNCALDNPFLPPISPLDYTNCSTQPKQEPSIFD 134
>BRO1_USTMA (Q4PHA8) Vacuolar protein-sorting protein BRO1 (BRO| domain-containing protein 1) Length = 1076 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 30 HPAPSTYHFHSSAAATRGTAG 92 HPAP T H H+S A+ G AG Sbjct: 813 HPAPPTPHRHTSYASAYGGAG 833 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,509,524 Number of Sequences: 219361 Number of extensions: 207046 Number of successful extensions: 1445 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1444 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)