| Clone Name | bast44f03 |
|---|---|
| Clone Library Name | barley_pub |
>V18K_MLVAB (P03400) 18 kDa protein| Length = 163 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 41 APPPACSRFQCLCQACPDSGPPCHPSLARPCL 136 AP A S C C+ GP CH + P L Sbjct: 61 APRSAWSALPCPCRTTSSDGPSCHQGMGAPVL 92
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 38 RAPPPACSRFQCLCQA--CPDSGPPCHPSLARPCLRPVG 148 RA P C C+C CP S P C P C + G Sbjct: 5413 RAENPCCPETVCVCNTTTCPQSLPVCPPGQESICTQEEG 5451
>TOP2A_RAT (P41516) DNA topoisomerase 2-alpha (EC 5.99.1.3) (DNA topoisomerase| II, alpha isozyme) Length = 1526 Score = 28.1 bits (61), Expect = 6.0 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 Query: 117 LSPDRVSAPSELARDDDDSVFAGNLASAEDAPAST 221 L P + S +L D DSV A ASA D PA T Sbjct: 1365 LKPQKSSTSVDLESDGKDSVPASPGASAADVPAET 1399
>BCSB2_ACEXY (O82860) Cyclic di-GMP-binding protein precursor (Cellulose| synthase regulatory subunit) (Cellulose synthase protein B) (CDGBP) Length = 802 Score = 27.7 bits (60), Expect = 7.9 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 14 ASAFASPLRAPPPACSRFQCLCQACPDSGPPCHPSLARPCLRP 142 A+ AS AP PA S L A P + PP S A P P Sbjct: 18 AAPVASKAPAPQPAGSDLPPLPAAPPQAAPPAAASAAPPATTP 60
>SLIT2_MOUSE (Q9R1B9) Slit homolog 2 protein precursor (Slit-2) [Contains: Slit| homolog 2 protein N-product; Slit homolog 2 protein C-product] Length = 1521 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = -1 Query: 278 LGRSGVHGEVIPVDQAETNC----GSGGVLC 198 LG VHG +P++ +C G GGVLC Sbjct: 1368 LGNKCVHGTCLPINAFSYSCKCLEGHGGVLC 1398
>TRH_ONCNE (Q8QFQ9) Thyroliberin type A precursor [Contains: Prothyroliberin| type A; Thyroliberin (Thyrotropin-releasing hormone) (TRH) (Thyrotropin-releasing factor) (TRF) (TSH-releasing factor) (Protirelin)] Length = 258 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -3 Query: 279 ARPQWRSRRSHPGGPSGNELWKRGRPLQKQ 190 ++P+W +R HPG EL KR P +++ Sbjct: 69 SQPEWLVKRQHPGKRYQEELEKRQHPGKRE 98
>TMPSD_MOUSE (Q5U405) Transmembrane protease, serine 13 (EC 3.4.21.-) (Mosaic| serine protease) (Membrane-type mosaic serine protease) Length = 543 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = +2 Query: 11 GASAFASPLRAPPPACSRFQCLCQACPDSGPPCHPSLARPCLRPVGTSP 157 G+ +SP R PP A +A P + P P A P P SP Sbjct: 4 GSHRNSSPARTPPQASPARTSPARAPPQASPARTPPQASPARTPPQASP 52
>LCE5A_HUMAN (Q5TCM9) Late cornified envelope protein 5A (Late envelope protein| 18) (Small proline-rich-like epidermal differentiation complex protein 5A) Length = 118 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = +2 Query: 44 PPPACSRF---QCLCQACPDSGPPCHPSLARPCLRPVGT 151 PPP C+ +C + P P C P + PC PV + Sbjct: 12 PPPKCTPKCPPKCTPKCPPKCPPKCPPQCSAPCPPPVSS 50
>KELC_DROME (Q04652) Ring canal kelch protein [Contains: Kelch short protein]| Length = 1477 Score = 27.7 bits (60), Expect = 7.9 Identities = 19/58 (32%), Positives = 27/58 (46%) Frame = +3 Query: 90 QTQALLATPLSPDRVSAPSELARDDDDSVFAGNLASAEDAPASTVRFRLVHRDDFSVN 263 Q Q A P P R+ + D D AG + SA D P + VR L +R +F ++ Sbjct: 827 QQQQQQAQPQQPQRILPMNNYRNDLYDRSAAGGVCSAYDVPRA-VRSGLGYRRNFRID 883
>PDZK3_RAT (Q9QZR8) PDZ domain-containing protein 3 (PDZ domain-containing| protein 2) (Plakophilin-related armadillo repeat protein-interacting PDZ protein) Length = 2766 Score = 27.7 bits (60), Expect = 7.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 86 CPDSGPPCHPSLARPCLRPVGTSP 157 C + PCHP++ P P G +P Sbjct: 1135 CGPASTPCHPNIGLPTENPQGAAP 1158
>HIS5_MYCPA (P60600) Imidazole glycerol phosphate synthase subunit hisH (EC| 2.4.2.-) (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit hisH) (ImGP synthase subunit hisH) (IGPS subunit hisH) Length = 206 Score = 27.7 bits (60), Expect = 7.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 132 HGRAREGWQGGPESGQAWQRH 70 H A + W+G PE+ W RH Sbjct: 148 HSYAAQQWEGSPEAVLTWSRH 168
>SLIT2_HUMAN (O94813) Slit homolog 2 protein precursor (Slit-2) [Contains: Slit| homolog 2 protein N-product; Slit homolog 2 protein C-product] Length = 1529 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = -1 Query: 278 LGRSGVHGEVIPVDQAETNC----GSGGVLC 198 LG VHG +P++ +C G GGVLC Sbjct: 1376 LGNKCVHGTCLPINAFSYSCKCLEGHGGVLC 1406 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,944,546 Number of Sequences: 219361 Number of extensions: 616380 Number of successful extensions: 2505 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2496 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)