| Clone Name | bast44f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MLL2_HUMAN (O14686) Myeloid/lymphoid or mixed-lineage leukemia p... | 30 | 3.5 | 2 | TOIP2_RAT (Q6P752) Torsin-1A-interacting protein 2 | 29 | 5.9 | 3 | ICP0_HHV11 (P08393) Trans-acting transcriptional protein ICP0 (I... | 29 | 5.9 |
|---|
>MLL2_HUMAN (O14686) Myeloid/lymphoid or mixed-lineage leukemia protein 2| (ALL1-related protein) Length = 5262 Score = 29.6 bits (65), Expect = 3.5 Identities = 18/52 (34%), Positives = 22/52 (42%) Frame = -3 Query: 367 PPKRQTERASQPLLEPTHRPPERMFLSSKERCVGSEAAEGRHLASSRTTRSD 212 PP QTE E + P + SS E +G EA HL S R + D Sbjct: 4408 PPHNQTEDVRMESDEDSDSPDSIVPASSPESILGEEAPRFPHLGSGRWEQED 4459
>TOIP2_RAT (Q6P752) Torsin-1A-interacting protein 2| Length = 578 Score = 28.9 bits (63), Expect = 5.9 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Frame = -3 Query: 310 PPERMFLSSKERCVGSEAAEG----RHLASSRTTRSDG--DGGESAQ 188 PPE L S A EG HL SS S+G +GGE+AQ Sbjct: 213 PPEEAHLESSSAAPSEGAGEGGEADAHLESSSAAPSEGAGEGGETAQ 259
>ICP0_HHV11 (P08393) Trans-acting transcriptional protein ICP0 (Immediate-early| protein IE110) (VMW110) (Alpha-0 protein) Length = 775 Score = 28.9 bits (63), Expect = 5.9 Identities = 16/60 (26%), Positives = 24/60 (40%) Frame = -3 Query: 367 PPKRQTERASQPLLEPTHRPPERMFLSSKERCVGSEAAEGRHLASSRTTRSDGDGGESAQ 188 PP RA P EP RP + + + A + + L +R T + G GG + Sbjct: 412 PPPGPGPRAPAPGAEPAARPADARRVPQSHSSLAQAANQEQSLCRARATVARGSGGPGVE 471 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,986,626 Number of Sequences: 219361 Number of extensions: 491944 Number of successful extensions: 1671 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1670 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)