| Clone Name | bast44e06 |
|---|---|
| Clone Library Name | barley_pub |
>PLMN_BOVIN (P06868) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 812 Score = 30.0 bits (66), Expect = 1.6 Identities = 18/55 (32%), Positives = 22/55 (40%) Frame = +2 Query: 2 PEAGLRCPTAR*PRTHKGCWSIKTAGRWSWKSKSAKECVTTHLPNQLAPKMDGAE 166 P AGL R P K W T R W+ + K+C T AP+ G E Sbjct: 424 PNAGLTMNYCRNPDADKSPWCYTTDPRVRWEFCNLKKCSETPEQVPAAPQAPGVE 478
>PLIN_HUMAN (O60240) Perilipin (PERI) (Lipid droplet-associated protein)| Length = 522 Score = 29.3 bits (64), Expect = 2.8 Identities = 21/62 (33%), Positives = 26/62 (41%) Frame = +1 Query: 76 RTVVMEVEIR*GVCNNSPAESTSPENGWR*SARPTPGHLGKRHAPMSRRARRPLQNPGRE 255 R +ME E +N PAE E R S P+ G RR+ R Q+PG Sbjct: 406 RLSLMEPESEFRDIDNPPAEVERREAERRASGAPSAGPEPAPRLAQPRRSLRSAQSPGAP 465 Query: 256 PG 261 PG Sbjct: 466 PG 467
>IF2_COREF (Q8FPA7) Translation initiation factor IF-2| Length = 964 Score = 28.9 bits (63), Expect = 3.6 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 12/58 (20%) Frame = +1 Query: 124 SPAESTSPENGWR*SARPTPGHLGKR------------HAPMSRRARRPLQNPGREPG 261 +PA+ T+P+ + PTPG K+ AP RP+ PG +PG Sbjct: 123 APAKPTAPKPATPAFSGPTPGDAAKKAAEDKATPKPGGEAPRPNAMPRPMAKPGPKPG 180
>NUP88_RAT (O08658) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) (Nucleoporin Nup84) Length = 742 Score = 28.9 bits (63), Expect = 3.6 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 85 VMEVEIR*GVCNNSPAESTSPENGWR*SARPTPGHLGKRH 204 V+ + +R G+ N SPAE+ P S P P HL R+ Sbjct: 22 VVFLRLREGLKNQSPAEADKPATSTSPSCPPLPPHLPTRN 61
>ATS20_MOUSE (P59511) ADAMTS-20 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 20) (ADAM-TS 20) (ADAM-TS20) Length = 1906 Score = 28.9 bits (63), Expect = 3.6 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 20 CPTAR*PRTHKGCWSIKTAGRWSWKSKSAKECVTT 124 C PRTHK C S + SWK+ KEC T Sbjct: 1452 CSHLHKPRTHKACRSGRCP---SWKANKWKECSVT 1483
>NLGN3_MACMU (Q8WMH2) Neuroligin-3 (Gliotactin homolog) (Fragment)| Length = 202 Score = 28.5 bits (62), Expect = 4.7 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -3 Query: 260 PGSRPGFCSGRRALLLIGAWRLPRWPGVGRALQRH 156 P +RPG SG+ + L A R+PR PG G +Q H Sbjct: 167 PMARPGAPSGQPSHLPT-ATRMPRGPGTGTRMQGH 200
>OPA1_MOUSE (P58281) Dynamin-like 120 kDa protein, mitochondrial precursor| (Large GTP-binding protein) (LargeG) Length = 960 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 80 RWS-WKSKSAKECVTTHLPNQLAPKMDGAEARDPHPAIWAS 199 RW WK+++ ++CV N+L + + D HPA AS Sbjct: 774 RWMYWKNRTQEQCVHNETKNELEKML---KVNDEHPAYLAS 811
>SYQ_CHRVO (Q7NX86) Glutaminyl-tRNA synthetase (EC 6.1.1.18) (Glutamine--tRNA| ligase) (GlnRS) Length = 560 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 7/30 (23%) Frame = -2 Query: 120 VTHSLADFDFHDHRPA-------VLIDQHP 52 +THSL +F DHRP + I+ HP Sbjct: 227 ITHSLCSLEFEDHRPLYDWVLDNISIEHHP 256
>CYSH_NEIMA (Q9JUD5) Phosphoadenosine phosphosulfate reductase (EC 1.8.4.8)| (PAPS reductase, thioredoxin dependent) (PAdoPS reductase) (3'-phosphoadenylylsulfate reductase) (PAPS sulfotransferase) Length = 244 Score = 28.1 bits (61), Expect = 6.2 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 74 AGRWSWKSKSAKEC 115 AGRW W+ K++KEC Sbjct: 227 AGRWWWEDKNSKEC 240
>PGMI_AERPE (Q9YE01) Bifunctional phosphoglucose/phosphomannose isomerase| (Glucose-6-phosphate isomerase) (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Mannose-6-phosphate isomerase) (EC 5.3.1.8) (Phosphomannose isomerase) (PMI) Length = 335 Score = 28.1 bits (61), Expect = 6.2 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 9/33 (27%) Frame = -2 Query: 234 RPPRPPTHR--GMALAQMAG-------CGSRAS 163 RPPRPP HR G+ LA +G CGS S Sbjct: 70 RPPRPPRHRGYGLVLASYSGNTLETVECGSLLS 102
>CAP16_ARATH (Q8L936) Putative clathrin assembly protein At4g40080| Length = 365 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 231 PPRPPTHRGMALAQMAGCGSRASAPS 154 P PP +R +A+ AG GSRA+A S Sbjct: 49 PSTPPGNRHLAVILSAGTGSRATASS 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,180,456 Number of Sequences: 219361 Number of extensions: 838051 Number of successful extensions: 2343 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2341 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)